Detailed information of component protein


Summary

Component ID T6CP010094
Component protein type TssD
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03990
Coordinate (Strand) 940506..941024 (+)
NCBI ID WP_004246976.1
RefSeq NC_022000
Uniprot ID A0A1Z1SWN0_PROMI, A0A264VKZ5_PRORE, A0A6G6Q8S8_9GAMM, A0A6I5JVP9_9GAMM, B4ETP9_PROMH
KEGG ID pvl:AOB99_06140, pvl:AOB99_07605, pmr:PMI1117
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 3.7e-35 7..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-172 MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPLLYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQLIEVSLSYRKIDWEHTVAGTSGADDWRAPLEA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9672 - -



  Protein sequence: 173 a.a.    

>T6CP010094 NC_022000:940506-941024 [Proteus mirabilis BB2000] [TssD]
MPTPCYISIEGKTQGNITAGAFTADSVGNIYVQGHEDQMLVQEFSHVVTVPTDPQSGQPSGQRAHKPFRFTVALNKAVPL
LYNALASGEMLPKVELKWYRTSVEGKQEHFFTTTLTDATIVNIDCQMPHCQDPAKADFTQLIEVSLSYRKIDWEHTVAGT
SGADDWRAPLEA*

  Nucleotide sequence: 519 bp    

>T6CP010094 NC_022000:940506-941024 [Proteus mirabilis BB2000] [TssD]
ATGCCAACTCCTTGCTATATTTCCATTGAAGGAAAAACTCAGGGCAACATCACTGCAGGCGCGTTTACTGCAGATTCTGT
CGGCAACATTTATGTACAAGGTCATGAAGACCAAATGTTGGTACAAGAATTTTCTCACGTGGTGACGGTTCCGACTGATC
CGCAATCAGGCCAACCTTCTGGCCAACGTGCGCATAAACCGTTTCGTTTTACCGTGGCATTAAACAAAGCCGTTCCTCTG
CTGTATAACGCATTGGCTTCCGGCGAAATGCTGCCAAAAGTTGAGTTAAAATGGTATCGCACGTCTGTTGAAGGTAAACA
AGAGCACTTCTTTACCACCACACTGACTGACGCGACGATCGTGAACATCGATTGCCAAATGCCTCATTGTCAAGATCCGG
CTAAAGCCGACTTCACGCAACTTATCGAAGTTTCCCTCTCTTACCGCAAAATTGACTGGGAGCACACTGTTGCTGGAACG
TCTGGTGCGGATGACTGGCGTGCGCCTCTCGAAGCGTAA