Detailed information of component protein


Summary

Component ID T6CP010092
Component protein type TssC
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (493 a.a.); Nucleotide sequence (1479 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03980
Coordinate (Strand) 936610..938088 (-)
NCBI ID WP_004247652.1
RefSeq NC_022000
Uniprot ID A0A1Z1SY37_PROMI, A0A6I5JN81_9GAMM
KEGG ID pvl:AOB99_06130
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 7.6e-123 66..365
VipB_2 PF18945.2 4.1e-44 379..489

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-492 MSLNAEAQEQQAPASTGSLLDEIMAQSRMSPETEAYDIAKQGVAAFISNIFASESEDQQINRLLIDKMLVELDNKLSTQVDEILHAPKFQEIEASWRSLKLLVDRTDFRENIKINILHATKEELLEDFEFSPEIVQSGFYQHVYSSGYGQFGGEPVATVIGNYAFNNTAPDMKLMQYVSTVGAMAHAPFLSSVSPNFFGINSYAELPAIKDLKSVFEGPAHTKWRSLREAEDSRYLGLTAPRFLLRLPYSPTENPVKMFNYSENVKQDHEHYLWGNTAFLLASCINDSFAKYRWCPNIIGPQSGGTVNDLPVHIFEAMGELQTKIPTEVLVTDRREFELAEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTPEGKLAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLERELNIWLKQYVADQENPPADVRSKRPLRSAEIKVLDVDGDPGWYQVAIQVRPHFKYMGANFELSLVGRLDKE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9809 - -



  Protein sequence: 493 a.a.    

>T6CP010092 NC_022000:c938088-936610 [Proteus mirabilis BB2000] [TssC]
MSLNAEAQEQQAPASTGSLLDEIMAQSRMSPETEAYDIAKQGVAAFISNIFASESEDQQINRLLIDKMLVELDNKLSTQV
DEILHAPKFQEIEASWRSLKLLVDRTDFRENIKINILHATKEELLEDFEFSPEIVQSGFYQHVYSSGYGQFGGEPVATVI
GNYAFNNTAPDMKLMQYVSTVGAMAHAPFLSSVSPNFFGINSYAELPAIKDLKSVFEGPAHTKWRSLREAEDSRYLGLTA
PRFLLRLPYSPTENPVKMFNYSENVKQDHEHYLWGNTAFLLASCINDSFAKYRWCPNIIGPQSGGTVNDLPVHIFEAMGE
LQTKIPTEVLVTDRREFELAEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTPEGKLAETNYKLGTQLPYMFIINRLAH
YIKVLQREQIGSWKERQDLERELNIWLKQYVADQENPPADVRSKRPLRSAEIKVLDVDGDPGWYQVAIQVRPHFKYMGAN
FELSLVGRLDKE*

  Nucleotide sequence: 1479 bp    

>T6CP010092 NC_022000:c938088-936610 [Proteus mirabilis BB2000] [TssC]
ATGTCACTAAATGCAGAAGCTCAAGAGCAACAAGCCCCCGCATCTACAGGCTCTTTACTTGATGAAATTATGGCTCAATC
ACGTATGTCTCCAGAAACAGAAGCATACGATATTGCCAAACAAGGTGTTGCTGCTTTTATTAGTAATATTTTCGCCAGTG
AATCTGAAGACCAACAGATCAATCGATTATTAATCGATAAAATGCTTGTTGAACTTGATAATAAACTAAGTACTCAAGTT
GACGAAATTCTTCACGCGCCTAAATTTCAAGAAATTGAAGCTTCATGGCGTTCTTTAAAATTACTCGTTGATCGCACTGA
TTTTAGAGAAAATATTAAGATCAATATTCTTCATGCAACTAAAGAAGAGTTATTAGAAGATTTTGAATTTTCTCCAGAAA
TTGTTCAATCAGGCTTCTATCAACACGTCTACTCTTCAGGATACGGCCAATTTGGTGGTGAACCTGTTGCAACAGTTATT
GGTAACTACGCCTTTAACAATACTGCGCCAGATATGAAGTTAATGCAGTATGTTAGTACTGTTGGTGCAATGGCTCACGC
GCCATTCCTATCATCTGTTTCACCTAATTTCTTTGGTATTAATAGCTACGCTGAACTGCCGGCAATTAAAGATCTAAAAT
CTGTTTTTGAAGGCCCTGCACACACTAAATGGCGCTCACTGCGTGAAGCAGAAGATTCCCGTTATTTAGGGTTAACAGCA
CCGCGTTTCTTATTACGTTTGCCATACTCTCCAACAGAAAACCCTGTAAAAATGTTTAACTATTCAGAAAATGTTAAACA
AGACCATGAGCACTATTTATGGGGTAATACCGCATTCTTATTAGCAAGCTGTATTAATGATAGTTTTGCAAAATATCGTT
GGTGTCCAAACATTATTGGCCCACAAAGCGGCGGTACAGTTAATGATCTTCCTGTGCATATTTTTGAAGCGATGGGTGAA
TTACAAACTAAGATCCCAACTGAAGTTTTAGTTACCGATCGTAGAGAATTTGAACTAGCAGAGGAAGGCTTTATCACGCT
GACCATGCGTAAAGGCAGTGATAATGCTGCATTCTTCTCAGCAAACTCGGTTCAAAAACCAAAAGTCTTCCCAAATACTC
CTGAAGGCAAATTGGCAGAGACTAACTATAAGTTAGGAACTCAATTGCCATACATGTTTATTATCAATCGCTTAGCTCAT
TATATAAAAGTATTGCAACGTGAACAGATTGGCTCATGGAAAGAGCGTCAAGATCTGGAGCGTGAACTCAATATTTGGCT
TAAGCAATATGTCGCAGATCAAGAAAACCCACCAGCAGATGTTCGTAGTAAACGTCCATTGCGTTCAGCTGAAATCAAAG
TACTTGATGTTGATGGCGATCCAGGTTGGTACCAAGTCGCTATTCAAGTTCGCCCACATTTTAAATATATGGGTGCAAAC
TTTGAATTATCACTTGTTGGTCGTCTTGATAAAGAGTAA