Detailed information of component protein


Summary

Component ID T6CP010090
Component protein type TssF
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (592 a.a.); Nucleotide sequence (1776 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03970
Coordinate (Strand) 934390..936165 (-)
NCBI ID WP_017628432.1
RefSeq NC_022000
Uniprot ID A0A6I5JTP8_9GAMM
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 1.3e-118 5..586

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-591 MSSKSYFTNESEYLNELTEQVAKEKPQLVNLLSHNVKDPDTSRIMDGLSYLSGNLRQQIDRQFPELTNSLANMLWPNYARPVPSMTIVEYHPNYAQCQHATKISAGQPFSATPLYVQSEETNHETLFQCRFSQSRDLWLMPTKISNILQQTTAIEITFELATKQPLANIGLDKLCFYLNGAPFTTNQLYFLLSQHVQSASLVTDVHTLPLTHFSVTPVGFQKQDALLPYPKNSYDGYRILQEFFCFPEAFLFLDIHGLDDIPLAIEAEQFKLVINFDLEIPDGVILYDDSIKLNCTPIVNLFPIDSEAINLTGKSEEYVLSPNYQLTECFDIFSINEVRGLRYPNDAKPYPITYTAFESFYHQNHQTQNHGYYRLKISQNEQLYGYSHRLSFVRQQEPQLQQCEETVSVALNCTNRYIASQLSTRSIDLDSASIPYGALSAKNLFAPTLPLYPLLDKTLYWSELTNLSLNYQSLLNLDSLKKILQLYDLPSVYNTQVARQSQKRLDALVDLHSEHIEHIYKGLPVRGLKTTLVVHQNAFLSEGSLFLFCTVIAQFFTLYTSINMFHELEVINLDNKEVYRWPAQINQHILK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9931 - -



  Protein sequence: 592 a.a.    

>T6CP010090 NC_022000:c936165-934390 [Proteus mirabilis BB2000] [TssF]
MSSKSYFTNESEYLNELTEQVAKEKPQLVNLLSHNVKDPDTSRIMDGLSYLSGNLRQQIDRQFPELTNSLANMLWPNYAR
PVPSMTIVEYHPNYAQCQHATKISAGQPFSATPLYVQSEETNHETLFQCRFSQSRDLWLMPTKISNILQQTTAIEITFEL
ATKQPLANIGLDKLCFYLNGAPFTTNQLYFLLSQHVQSASLVTDVHTLPLTHFSVTPVGFQKQDALLPYPKNSYDGYRIL
QEFFCFPEAFLFLDIHGLDDIPLAIEAEQFKLVINFDLEIPDGVILYDDSIKLNCTPIVNLFPIDSEAINLTGKSEEYVL
SPNYQLTECFDIFSINEVRGLRYPNDAKPYPITYTAFESFYHQNHQTQNHGYYRLKISQNEQLYGYSHRLSFVRQQEPQL
QQCEETVSVALNCTNRYIASQLSTRSIDLDSASIPYGALSAKNLFAPTLPLYPLLDKTLYWSELTNLSLNYQSLLNLDSL
KKILQLYDLPSVYNTQVARQSQKRLDALVDLHSEHIEHIYKGLPVRGLKTTLVVHQNAFLSEGSLFLFCTVIAQFFTLYT
SINMFHELEVINLDNKEVYRWPAQINQHILK*

  Nucleotide sequence: 1776 bp    

>T6CP010090 NC_022000:c936165-934390 [Proteus mirabilis BB2000] [TssF]
ATGTCATCAAAATCCTACTTTACCAATGAATCAGAATACTTAAATGAGCTGACTGAGCAAGTTGCCAAAGAAAAACCGCA
ACTTGTTAATTTGCTTTCGCACAATGTTAAAGATCCTGATACTTCGCGGATTATGGATGGGCTATCTTATTTATCGGGTA
ATTTACGCCAGCAAATAGATAGACAATTTCCTGAGTTAACTAACAGTTTAGCCAATATGCTTTGGCCAAACTACGCGCGC
CCTGTGCCAAGCATGACGATTGTTGAATATCATCCTAATTATGCTCAGTGCCAACACGCAACAAAAATTTCAGCAGGACA
ACCTTTTAGTGCCACTCCACTTTATGTGCAAAGTGAGGAAACAAACCACGAGACGTTATTTCAATGTCGATTTAGTCAAA
GTCGCGACCTCTGGTTAATGCCGACAAAAATCAGTAACATTTTGCAGCAAACAACCGCCATTGAAATAACATTTGAGTTA
GCAACAAAACAGCCACTTGCCAATATTGGCTTAGATAAATTGTGTTTTTACTTAAATGGTGCGCCATTTACTACAAATCA
GCTCTATTTTTTATTAAGCCAGCATGTGCAGAGTGCCTCTTTAGTCACAGATGTACATACGCTACCTCTTACTCACTTTT
CAGTTACGCCTGTTGGTTTTCAAAAGCAGGATGCCTTACTTCCATACCCGAAAAATAGCTATGATGGCTATCGTATACTG
CAAGAGTTTTTCTGTTTTCCTGAAGCCTTTCTCTTTCTAGATATTCATGGTTTGGATGACATTCCTTTGGCTATCGAAGC
AGAGCAATTCAAACTGGTGATCAATTTTGATCTAGAAATTCCTGATGGCGTTATTCTTTACGACGACAGTATTAAACTTA
ATTGCACCCCTATTGTGAATTTATTTCCTATTGATAGTGAAGCAATAAATTTGACGGGGAAAAGTGAGGAGTATGTTTTA
AGTCCTAATTACCAACTTACTGAATGTTTTGATATTTTTTCGATTAATGAGGTTAGAGGGTTACGTTATCCTAATGATGC
TAAACCTTATCCGATCACCTATACAGCATTTGAAAGTTTTTATCATCAAAACCATCAGACTCAAAATCATGGCTATTACC
GTTTAAAGATAAGTCAAAATGAACAGTTATACGGCTATTCCCATCGACTTTCTTTTGTTCGTCAGCAAGAGCCTCAGTTA
CAACAGTGTGAAGAAACCGTTTCTGTTGCACTCAACTGTACTAACCGCTATATCGCTTCCCAGTTATCGACGCGTTCTAT
CGATTTAGATAGTGCATCAATTCCTTATGGGGCTTTATCTGCTAAGAATTTATTCGCACCAACACTGCCTTTATATCCAT
TATTAGATAAAACATTATATTGGTCTGAATTAACTAATTTATCTTTAAATTATCAGTCTTTGCTCAATCTTGATTCATTA
AAAAAAATATTACAACTCTATGATTTACCGTCTGTTTATAACACACAGGTTGCAAGGCAATCACAAAAACGCCTAGATGC
ATTAGTTGATTTACATTCAGAGCATATTGAGCATATCTACAAAGGCCTTCCTGTTCGCGGTCTGAAGACAACGTTAGTTG
TTCATCAAAATGCGTTTCTTTCGGAAGGAAGTTTATTCCTATTTTGTACCGTTATCGCTCAATTTTTCACCTTATATACC
AGCATTAATATGTTTCATGAGTTGGAAGTTATTAACCTTGATAATAAGGAAGTTTATCGATGGCCAGCACAAATCAACCA
GCACATACTGAAGTAA