Detailed information of component protein


Summary

Component ID T6CP010088
Component protein type TssJ
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (184 a.a.); Nucleotide sequence (552 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03955
Coordinate (Strand) 931563..932114 (-)
NCBI ID WP_004244619.1
RefSeq NC_022000
Uniprot ID A0A1Z1SXK8_PROMI, A0A6I5JSV7_9GAMM, B4ET55_PROMH
KEGG ID pvl:AOB99_06105, pmr:PMI0743
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 1.3e-26 51..173

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-183 MQLRTFSILLLFSSFLILSGCSKPFEAAGKMGKILLDPSTPVGQPKDQPSTVALTILAEPYINPNQEGEAAPINIQVVYLNEDSVFGSVDHDQIDAKEGDLEKVLKKNYIDHQDYTILPGQYKPFPTMTLDPSNRYIGIIAYYSDPDKAEWKKIVKARGKGRHYFLLVHIRENEIEFRQEEDD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9992 pos: 20-21. LSG-CS. MQLRTFSILLLFSSFLILSG



  Protein sequence: 184 a.a.    

>T6CP010088 NC_022000:c932114-931563 [Proteus mirabilis BB2000] [TssJ]
MQLRTFSILLLFSSFLILSGCSKPFEAAGKMGKILLDPSTPVGQPKDQPSTVALTILAEPYINPNQEGEAAPINIQVVYL
NEDSVFGSVDHDQIDAKEGDLEKVLKKNYIDHQDYTILPGQYKPFPTMTLDPSNRYIGIIAYYSDPDKAEWKKIVKARGK
GRHYFLLVHIRENEIEFRQEEDD*

  Nucleotide sequence: 552 bp    

>T6CP010088 NC_022000:c932114-931563 [Proteus mirabilis BB2000] [TssJ]
ATGCAGCTTAGAACTTTCTCAATATTACTGTTATTTAGCTCTTTTTTAATATTGAGTGGATGTAGTAAACCTTTTGAAGC
CGCGGGTAAAATGGGGAAAATCTTATTAGATCCCTCAACTCCTGTTGGGCAACCGAAAGATCAGCCCTCTACCGTTGCAT
TAACCATCCTTGCGGAGCCCTATATTAATCCTAATCAGGAAGGTGAAGCTGCGCCGATAAATATCCAAGTTGTTTATCTT
AATGAAGATTCAGTATTTGGCTCTGTTGATCATGATCAGATAGATGCAAAAGAGGGTGACTTAGAGAAAGTTCTAAAGAA
AAATTATATTGACCATCAAGACTACACCATTTTACCTGGCCAATATAAACCCTTCCCTACTATGACGTTAGACCCATCTA
ACCGTTACATTGGCATTATTGCCTATTACTCAGATCCTGATAAAGCAGAATGGAAGAAAATAGTCAAAGCGCGTGGTAAA
GGACGCCACTACTTCCTATTAGTGCACATTAGGGAAAATGAAATCGAATTTAGACAAGAAGAGGATGATTAA