Detailed information of component protein


Summary

Component ID T6CP010086
Component protein type TssL
T6SS ID (Type) T6SS00838 experimental (Type i1)
Strain Proteus mirabilis BB2000
Replicon chromosome
Sequence Protein sequence (252 a.a.); Nucleotide sequence (756 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BB2000_RS03945
Coordinate (Strand) 929455..930210 (-)
NCBI ID WP_004244617.1
RefSeq NC_022000
Uniprot ID A0A1Z1SWQ8_PROMI, A0A6I5JUA5_9GAMM, B4ET53_PROMH
KEGG ID pmr:PMI0741, pvl:AOB99_06095
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 7.2e-56 31..232

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-210 MTDDILLNHDDEERITKKNYQLPLRGNNINPMIDAATPLLGMVLRMKAMSETPLSEKLYQQVVMDITSIEQQLQIQGYEPGAIVSFRYVLCTFIDETALGLGWDQDNGWVKQSLLVHFHNESWGGEKVFVLIERLLGEPKRYLDLIEFIYLCLCLGYRGRYKVSAGQNDEFNHLLRRLQKQIQQLRGNAKPIVLFEKGDNQQSRYRLGKR
Transmembrane helix 211-233 LGARYILIGTAVFALIIYSIYSS
Outside 234-251 RLNYQTLSIVEQLNTLLG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9827 - -



  Protein sequence: 252 a.a.    

>T6CP010086 NC_022000:c930210-929455 [Proteus mirabilis BB2000] [TssL]
MTDDILLNHDDEERITKKNYQLPLRGNNINPMIDAATPLLGMVLRMKAMSETPLSEKLYQQVVMDITSIEQQLQIQGYEP
GAIVSFRYVLCTFIDETALGLGWDQDNGWVKQSLLVHFHNESWGGEKVFVLIERLLGEPKRYLDLIEFIYLCLCLGYRGR
YKVSAGQNDEFNHLLRRLQKQIQQLRGNAKPIVLFEKGDNQQSRYRLGKRLGARYILIGTAVFALIIYSIYSSRLNYQTL
SIVEQLNTLLG*

  Nucleotide sequence: 756 bp    

>T6CP010086 NC_022000:c930210-929455 [Proteus mirabilis BB2000] [TssL]
ATGACTGATGATATTTTACTGAATCATGATGATGAAGAGCGCATTACAAAGAAAAATTACCAACTGCCGCTAAGAGGAAA
CAACATCAATCCAATGATAGATGCGGCTACACCTTTATTAGGCATGGTATTGCGCATGAAAGCGATGTCTGAAACCCCAC
TTTCAGAAAAGCTTTACCAACAAGTTGTCATGGATATTACCTCTATTGAGCAACAATTACAGATCCAAGGTTACGAGCCA
GGTGCCATTGTTTCATTTCGTTATGTGCTATGTACTTTTATTGATGAAACCGCCCTTGGATTAGGCTGGGATCAAGATAA
TGGTTGGGTAAAACAATCATTACTGGTTCATTTTCATAATGAATCATGGGGTGGTGAAAAAGTCTTTGTCTTAATTGAAA
GATTATTAGGTGAACCTAAACGTTACCTCGATCTGATTGAATTTATCTACCTTTGTTTATGCCTAGGATACCGCGGGCGC
TACAAAGTCTCTGCGGGACAAAATGATGAATTTAATCATTTATTAAGACGCTTACAAAAACAGATCCAACAGCTAAGAGG
TAACGCTAAGCCAATAGTTCTATTTGAAAAAGGTGATAACCAACAAAGCCGTTATCGTTTAGGTAAGCGTTTAGGGGCTC
GCTATATTCTCATAGGTACAGCGGTATTCGCGTTGATTATTTATAGCATTTATTCATCCAGACTGAATTATCAAACACTC
AGTATTGTGGAACAACTTAATACTTTACTTGGCTAG