Detailed information of component protein


Summary

Component ID T6CP009577
Component protein type TssE
T6SS ID (Type) T6SS00013 experimental (Type i1)
Strain Pseudomonas putida KT2440
Replicon chromosome
Sequence Protein sequence (137 a.a.); Nucleotide sequence (411 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PP_RS13670
Coordinate (Strand) 2998577..2998987 (-)
NCBI ID WP_010953542.1
RefSeq NC_002947
Uniprot ID A0A0A7Q2N6_PSEPU, Q88JM7_PSEPK, A0A2L0T009_9PSED, A0A4U9LYP3_PSEPU, A0A2V4FI10_9PSED
KEGG ID ppu:PP_2622
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 1e-18 29..115

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-136 MSGLFDRLMVDQCTRREASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDVSNGDLLVQVSADIRRTLQRFEPRIQVRTLNAVPDTHAPLELHFRLDCLVQVNNHAEQLQLELLVDGHNRYTRVR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9662 - -



  Protein sequence: 137 a.a.    

>T6CP009577 NC_002947:c2998987-2998577 [Pseudomonas putida KT2440] [TssE]
MSGLFDRLMVDQCTRREASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDVSNGDLLVQVSADIRRTLQ
RFEPRIQVRTLNAVPDTHAPLELHFRLDCLVQVNNHAEQLQLELLVDGHNRYTRVR*

  Nucleotide sequence: 411 bp    

>T6CP009577 NC_002947:c2998987-2998577 [Pseudomonas putida KT2440] [TssE]
ATGAGTGGTCTTTTTGATCGCCTGATGGTGGACCAGTGCACCCGCCGAGAGGCCTCCCGACGGGAGAGCGCTTCCCACAA
GTTCGCCGCCATCAAGCGCCACCTCGAAACGCTGCTGAATGCCCGCCAGGGGTGCTCCCAGAGCAGCCCTGAGCTGGGCC
TGCGCGACTTCAATGGGCATGACGTGAGCAACGGCGACTTGCTTGTGCAGGTGAGCGCGGATATCCGCCGCACCCTCCAG
CGCTTCGAGCCGCGCATACAGGTACGCACGCTCAACGCAGTGCCCGATACCCATGCCCCGCTGGAGCTGCATTTCAGGCT
GGATTGCCTGGTACAGGTCAACAACCACGCAGAACAGCTGCAACTCGAGCTGCTGGTCGATGGGCACAACCGCTACACGC
GCGTGAGGTGA