Detailed information of component protein


Summary

Component ID T6CP009350
Component protein type TssJ
T6SS ID (Type) T6SS00070 experimental (Type i1)
Strain Burkholderia mallei ATCC 23344
Replicon chromosome II
Sequence Protein sequence (266 a.a.); Nucleotide sequence (798 bp)
Reference
[1] Schell MA, Ulrich RL, Ribot WJ, et al. Type VI secretion is a major virulence determinant in Burkholderia mallei. Mol Microbiol. 2007 Jun;64(6):1466-85. PMID: 17555434
[2] Shanks J, Burtnick MN, Brett PJ, et al. Burkholderia mallei tssM encodes a putative deubiquitinase that is secreted and expressed inside infected RAW 264.7 murine macrophages. Infect Immun. 2009 Apr;77(4):1636-48. doi: 10.1128/IAI.01339-08. Epub 2009 Jan 21. PMID: 19168747
[3] Burtnick MN, DeShazer D, Nair V, et al. Burkholderia mallei cluster 1 type VI secretion mutants exhibit growth and actin polymerization defects in RAW 264.7 murine macrophages. Infect Immun. 2010 Jan;78(1):88-99. doi: 10.1128/IAI.00985-09. Epub 2009 Nov 2. PMID: 19884331
[4] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BMA_RS19555
Coordinate (Strand) 744827..745624 (-)
NCBI ID WP_004200965.1
RefSeq NC_006349
Uniprot ID A5PM26_BURML, A0A0F6L265_BURPE, A0A0H2WE87_BURMA, A0A1S0SJM8_BURPE, A0A0E1VXS0_BURPE, A3NLA8_BURP6, A0A6C6YMI6_BURM7, C4ANU5_BURML, A0A7U8HA49_BURML, A3P6W0_BURP0, A2RXX3_BURM9, A0A0E1SC69_BURPE, A0A0E1TMK5_BURPE
KEGG ID bmaf:DM51_4432, bmaz:BM44_4701, bmae:DM78_3349, bmab:BM45_3157, bpd:BURPS668_A2135, bpl:BURPS1106A_A2037, bmai:DM57_11930, bmal:DM55_4710, but:X994_5607, bmaq:DM76_3662, bmn:BMA10247_A1685, bma:BMAA0733, bml:BMA10229_0727
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 9.8e-19 72..180

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-265 MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.7656 pos: 50-51. LAG-CA. MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAG



  Protein sequence: 266 a.a.    

>T6CP009350 NC_006349:c745624-744827 [Burkholderia mallei ATCC 23344] [TssJ]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAPDALRIDIDAS
ARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVA
GYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPS
ADANDGGSGKRDKRGNAAARAPRKQ*

  Nucleotide sequence: 798 bp    

>T6CP009350 NC_006349:c745624-744827 [Burkholderia mallei ATCC 23344] [TssJ]
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGTCATGGCCGTC
GCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGCCCTCGCCGGCTGTGCGGCCC
GCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCCGACGCGCTGCGCATCGATATCGACGCGTCG
GCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGTTGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCG
CCAGCTCGCCGACGATCCGGACCGGCTGCGCATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCC
GCTACGTCGTCGCGCCCGGCCAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCC
GGCTACTACGACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGACGCGCGCGAAG
CGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGAAGACCCTGGCGCTGCCGAGC
GCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGCCGCCGCCCGTGCGCCGCGCAAGCAATGA