Detailed information of component protein


Summary

Component ID T6CP009341
Component protein type TssJ
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (184 a.a.); Nucleotide sequence (552 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24410
Coordinate (Strand) 4902569..4903120 (+)
NCBI ID WP_000152745.1
RefSeq NC_017626
Uniprot ID A0A447X889_ECOLX, D3GUZ9_ECO44
KEGG ID elo:EC042_4573
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 2.5e-07 100..149

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-183 MTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFLQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVVAGYYPFPGKQHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9937 pos: 19-20. ITA-CS. MTIKCLLLAVMVCPFFITA



  Protein sequence: 184 a.a.    

>T6CP009341 NC_017626:4902569-4903120 [Escherichia coli 042] [TssJ]
MTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLFLQASDKNTLQD
IMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVVAGYYPFPGKQHMLLLDIPVDVVEEGWWNK
SLHASLLPLSKKISMGKESISMK*

  Nucleotide sequence: 552 bp    

>T6CP009341 NC_017626:4902569-4903120 [Escherichia coli 042] [TssJ]
ATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATGCCCCTTTTTCATCACTGCCTGTTCTGATAAGTATTCTGAACA
GGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTACTTTTCAGATATCATCTGATACGC
AATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTCTTACAGGCTTCAGATAAAAATACATTACAGGAC
ATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTATCGGGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATA
CGTGGCTATGCCGGGGCAGGAGATAACGCTACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGGTTGCTGGAT
ACTATCCATTTCCTGGAAAACAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAATAAA
TCATTACATGCATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA