Detailed information of component protein


Summary

Component ID T6CP009063
Component protein type TssM
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (1135 a.a.); Nucleotide sequence (3405 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24430
Coordinate (Strand) 4905486..4908890 (+)
NCBI ID WP_001403210.1
RefSeq NC_017626
Uniprot ID A0A3W3PIC0_ECOLX
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 1.1e-16 174..341

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-4 MLKK
Transmembrane helix 5-27 TFSLFLWFFVSVFVLSVCYVIGV
Inside 28-38 FRNWTDTTTAL
Transmembrane helix 39-61 YWISVILVTLSFKFIMDCIHNYF
Outside 62-1134 SAGKYRNFLKSFSRKKRALTLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLLEDINLPVFHRNCVNSTPQQFRTIRWWFFRDLSVLELSGKIYDNPGVINSVISSLSARKCKKQPPRGVVLVISADKLINHDYTYIRTLSQKTRSFVEQLSLHLHHNIPVFIVISGCEHISGYSVLAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSSLRSNIMASICHALDDSLSDKEKNDILQFPDRLKGLKYSLDIFISTFCIENVFFSQTEIAGICLSGELMGEKDKNCIFADILISEILPQIHDSDVIHVNKQRVNVSFKSVIAMTALCFVGYSGYCSYNVYNIRHGSVDTSHAFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNFMQASPSGKRELILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLAVERDEIQKNNGIENIYVFRNLLTELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYLSGIWTQPGQNKLHQWYETIKEAYGRDTVPEAFSSFVLYLDESRQEHFRQFIMSVARARKDSHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSAQDWLSEFRLLNHLFSLKVDNGMKRQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSVLHTASSVELIRNAMRSDPENKLVILFDEFEKVRSVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCWVGEQWRNSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNGVLALDPDGVRLLSFRERSIPFSPSFITFINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRVTIDSAPATIPDNPRVKPTGTTLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILFPNFSATYKFTGETAWIDFINKFSDGESELMTKDFSPESRNFLESMGIKGILVRYKLSDTGNLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSAWISRLPGNITICPVVQE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.8234 - -



  Protein sequence: 1135 a.a.    

>T6CP009063 NC_017626:4905486-4908890 [Escherichia coli 042] [TssM]
MLKKTFSLFLWFFVSVFVLSVCYVIGVFRNWTDTTTALYWISVILVTLSFKFIMDCIHNYFSAGKYRNFLKSFSRKKRAL
TLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLLEDINLPVFHRNCVNSTPQQFRTIRWWFFRDLSVLELSGKIYDN
PGVINSVISSLSARKCKKQPPRGVVLVISADKLINHDYTYIRTLSQKTRSFVEQLSLHLHHNIPVFIVISGCEHISGYSV
LAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSSLRSNIMASICHALDDSLSDKEKNDILQFPDRLKGLKYSLDIFI
STFCIENVFFSQTEIAGICLSGELMGEKDKNCIFADILISEILPQIHDSDVIHVNKQRVNVSFKSVIAMTALCFVGYSGY
CSYNVYNIRHGSVDTSHAFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNFMQA
SPSGKRELILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLAVERDEIQKNNGIENIYVFRNLLT
ELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYLSGIWTQPGQNKLHQWYETIKEAYGRDTVPEAFSSFVLYLDESR
QEHFRQFIMSVARARKDSHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSAQDWLSEFRLLNHLFSLKVDNGMK
RQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSVLHTASSVELIRNAMRSDPENKLVILFDEFEKVR
SVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCWVGEQWRNSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNG
VLALDPDGVRLLSFRERSIPFSPSFITFINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRVTID
SAPATIPDNPRVKPTGTTLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILFPNFSATYKFTGETAWIDFINKFS
DGESELMTKDFSPESRNFLESMGIKGILVRYKLSDTGNLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSAWIS
RLPGNITICPVVQE*

  Nucleotide sequence: 3405 bp    

>T6CP009063 NC_017626:4905486-4908890 [Escherichia coli 042] [TssM]
ATGCTTAAGAAGACATTTTCATTATTTCTCTGGTTTTTTGTTTCTGTCTTCGTTCTGTCTGTTTGCTATGTTATCGGCGT
GTTCAGAAACTGGACAGATACTACAACTGCACTTTACTGGATTTCTGTGATTCTTGTTACTCTTTCCTTTAAATTTATTA
TGGATTGTATCCATAATTACTTTTCTGCAGGAAAATACAGAAATTTTCTAAAGTCTTTCTCTCGTAAAAAGAGAGCATTG
ACGCTTGATTCGTATTTCAAAAAAGGTCTGAATATCATAAGTAAAAGGGGAAGAGGAGAGGTTCCTTGGTTCTTACTTAC
GGGAGATTCAGAAAAAAACAACTCTTTGCTTGAAGATATCAATCTTCCTGTCTTTCACCGTAATTGTGTAAATAGCACTC
CCCAACAATTCCGGACAATTCGTTGGTGGTTTTTCAGAGATTTAAGCGTGCTGGAGTTGTCAGGAAAGATATATGATAAC
CCGGGAGTAATAAACTCTGTGATAAGTTCTTTATCAGCACGTAAATGTAAAAAACAGCCACCTCGTGGCGTTGTTCTCGT
CATTTCTGCTGATAAGCTAATTAATCATGATTACACCTATATTCGGACATTGTCTCAAAAAACAAGGAGTTTTGTAGAAC
AACTGTCGTTACACTTACATCACAACATTCCGGTCTTTATAGTGATTAGTGGATGTGAGCACATCAGTGGATATTCAGTG
CTGGCACAAAAAATCTATCAAAAACATGAAAAATGGCATCCAGTGTTTTGGGCAACCAATAAATCAGGGACGAATGCATC
TGAATATGATTCATCATACATATTATCATCATTAAGATCTAATATAATGGCATCAATATGCCATGCGCTTGATGATTCAT
TAAGTGACAAGGAAAAAAATGATATACTGCAGTTTCCTGATAGATTGAAAGGTCTAAAGTATTCACTTGACATATTTATT
TCCACATTCTGTATTGAGAACGTTTTTTTCTCTCAGACGGAAATTGCCGGGATCTGTTTATCTGGTGAACTCATGGGGGA
GAAGGACAAAAACTGTATTTTTGCTGATATCCTTATTTCCGAGATACTGCCACAAATACATGATTCAGACGTTATTCATG
TTAACAAACAAAGAGTGAATGTATCGTTTAAATCAGTTATAGCCATGACTGCATTGTGTTTTGTTGGATATAGCGGATAT
TGTTCATATAATGTGTATAACATCAGACATGGTTCTGTTGATACCAGCCATGCATTTCTGACAGAGCAGATATCAAAATA
TGAAGACAAAGTTAGGTCTAACATGCGGTATTTCCCTTTTAAGCCTGCACTAGATGATAAATATCTATTTTTCAGAGAAT
CTCTTCATAAAACAACAAGATTCGATATCAGTCCTGTCTCATGGCGCGTTACTGAATATAAGAAGAATTTCATGCAAGCT
TCACCATCAGGAAAGCGAGAACTAATTCTGTCGCTCTCATCATCACTTATCAGTTGGGATAAGATGATGAAAGATGAATC
CCTGAGTGACTTAGCAAAATCTCCTGGTATTCATGAGTTACTGAAGATAACCAGACCTCATGATAAAATATCATCAATAG
CTTCACTTGCTGTAGAAAGAGATGAGATACAGAAAAATAATGGAATTGAGAATATTTATGTGTTCAGAAACCTCCTGACT
GAGTTGGTTCAGAGTGACCCGTCTTATTCATGGTTTGTTTCTGAAGATGTTAATATTCCTGCTGTAAGAATTACGGACTT
TTGGGAAGATGAAAACTCTTCTGTCTATCTTTCCGGAATATGGACACAACCGGGACAGAATAAACTTCATCAGTGGTATG
AGACTATCAAAGAGGCATATGGACGTGATACGGTTCCGGAGGCGTTCTCATCCTTTGTGCTATACCTGGATGAAAGTCGT
CAGGAGCATTTCAGACAGTTTATTATGTCTGTTGCAAGGGCACGTAAAGACTCACATTCAGGTTTAATGAATCCGCTGCA
ACTGACCAATATTATACACAATCGCTCATCTGAGCATAGATTCTTTCAGTTTGTAGATGATGAATTACACAATATACCAA
CGAGTTCGGCGCAGGACTGGCTTTCTGAATTCAGACTGCTTAACCATCTGTTTTCACTTAAAGTGGATAACGGAATGAAA
CGTCAAATAGAACAATTTGATCTCATGTTACGTATATACCTGATTTCTGTTCTTAATAACAGTCAAATGAACAGGACACT
GACTCATGTTACCACATGGAGAAGCTGGCAGAATGCTCTACGTAATGCCGTGAATTCAGTGTTACATACAGCATCATCAG
TTGAACTTATTCGTAATGCCATGCGTTCAGATCCAGAAAACAAGCTGGTAATATTATTTGATGAGTTTGAAAAGGTTCGC
TCAGTCATTAACAGCAATAATAGAGAGCCGGTGATTGATTCTGTATGGGATATTTATGAGCGGCAGATTTATCAACTTCT
CGACCATGCTGTCACTTATACAGGGTGTTGGGTTGGTGAACAATGGAGGAATTCTGTTTTAGGCCGGTTTAACTCAGGAA
AACATAATCTCAGTTATTCTGAGATGCAGGGAAAAGTATATAAGGACATTATTGGCTTTTTGAAAGGTCCGTCTAACGGA
GTTTTAGCGCTTGATCCAGACGGTGTCAGACTGTTGTCCTTCAGGGAAAGAAGTATACCTTTTTCCCCTTCATTCATTAC
TTTCATTAATGACATTGTTTCCCCGGATGATCTGCTTGATGTTTGGCTCAGAGAGCGAACGCAAAACAAGGATGAATTAA
TAAATGTACAGGGGCAACTAGACTTACTGAATCAGACCCTACAAAATGCTGAGTCACAGCCTTACAGAGTTACGATAGAT
AGTGCACCTGCGACAATTCCGGATAATCCCCGAGTCAAACCAACAGGTACAACTCTGACTCTTGAGTGTAAAACAGGTAA
CAGCAGTATACGAAGTATGAATTTTGCTGATTCAGGTATTTTTACCTGGTATCCGGGAAGCTGTCACTCTGTAAGAATTG
ACATTTTGTTCCCTAATTTTTCTGCCACCTATAAGTTTACAGGAGAAACAGCCTGGATTGATTTTATCAACAAGTTTTCG
GATGGAGAGAGTGAGTTAATGACAAAGGATTTTTCTCCAGAATCAAGAAATTTTCTCGAATCAATGGGGATTAAAGGCAT
TCTTGTCCGTTACAAACTGAGTGATACAGGCAATCTAAGTCAGGCATATATCGAATGGGAACAACTAAAACAGGAAAAGG
ATAAACTTAAAGATTTACAGGTGAATCTGAGTAATAAGCTGCTTACCACACATAGCTGGGAGAAAAGTGCCTGGATTTCC
AGACTGCCCGGCAATATAACAATATGTCCAGTAGTACAGGAGTGA