Detailed information of component protein


Summary

Component ID T6CP008835
Component protein type TssD
T6SS ID (Type) T6SS00367 insolico (Type i1)
Strain Escherichia coli O111:H- str. 11128
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Reference
-
insolico Bioinformatics investigation has been performed on this T6SS

External database links

Locus tag (Gene) ECO111_RS01220
Coordinate (Strand) 261961..262479 (+)
NCBI ID WP_001142958.1
RefSeq NC_013364
Uniprot ID A0A829E0Z0_ECOLX, A0A0E0Y4V8_ECO1C, L3QI00_ECOLX, A0A829AM71_ECOLX, U9YRG6_ECOLX, A0A829LCD5_ECOLX, V0YIY8_ECOLX, A0A7U9J1J4_ECOLX, W1EQY6_ECOLX, A0A836NEE7_ECOLX, A0A3D8XNL5_9ENTR, A0A6I4KHM9_9ENTR, A0A6H2GIT7_9ESCH, A0A7W4PWZ7_9ESCH, A0A8A5H6V1_ECOLX, A7ZHX3_ECO24, A0A7M3S2F6_ECOHS, A0A0E1SSY5_ECOLX, A0A0H3PHB8_ECO5C, D6I5D3_ECOLX, O52671_ECOLX, A0A7L6ZRT9_ESCFE, E0J653_ECOLW, A0A170UYG5_KLEOX, B7LHE1_ECO55, A0A7Z1J2J2_SHIFL, A0A7Z1D0C6_SHISO, A0A1X3JLW6_ECOLX, A0A1X3L786_ECOLX, F4VA08_ECOLX, A0A1X3IBM1_ECOLX, F4TA69_ECOLX, A0A1X3LM59_ECOLX, A0A1X3J5C3_ECOLX, E9XQ91_ECOLX, E6BQG9_ECOLX, E1IYR3_ECOLX, E1JBS7_ECOLX, D8E9U8_ECOLX, D7XRD3_ECOLX, E9TA15_ECOLX, A0A6M7H445_ECO57, Q7DC35_ECO57, I2UQJ1_ECOLX, I2WRX5_ECOLX, F0JUI5_ESCFE
KEGG ID ecw:EcE24377A_0243, elw:ECW_m0233, eck:EC55989_0235, ecs:ECs0234, ece:Z0266, ecx:EcHS_A0241, esl:O3K_20405
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5e-32 8..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
- -



  Protein sequence: 173 a.a.    

>T6CP008835 NC_013364:261961-262479 [Escherichia coli O111:H- str. 11128] [TssD]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPL
MYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGT
SGADDWRAPLEA*

  Nucleotide sequence: 519 bp    

>T6CP008835 NC_013364:261961-262479 [Escherichia coli O111:H- str. 11128] [TssD]
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCGCTGATTCTGT
CGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAACGTTACTGTCCCGACCGATC
CTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTTACCGTGGCGCTGAACAAAGCGGTTCCGCTG
ATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCACTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACA
GGAGCATTATTTCACTACCCGCCTGACTGATTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGG
CGAAACGCGAGTTCACCCAGTTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACC
TCCGGTGCCGACGACTGGCGCGCACCGCTGGAAGCATAA