Detailed information of component protein


Summary

Component ID T6CP008835
Component protein type TssD
T6SS ID (Type) T6SS00367 insolico (Type i1)
Strain Escherichia coli O111:H- str. 11128
Replicon chromosome
Sequence Protein sequence (173 a.a.); Nucleotide sequence (519 bp)
Reference
-
insolico Bioinformatics investigation has been performed on this T6SS

External database links

Locus tag (Gene) ECO111_RS01220
Coordinate (Strand) 261961..262479 (+)
NCBI ID WP_001142958.1
RefSeq NC_013364
Uniprot ID A0A026UT97_ECOLX, A0A069XJI7_ECOLX, A0A070F8I2_ECOLX, A0A070ULD2_ECOLX, A0A073G398_ECOLX, A0A073HU66_ECOLX, A0A073UDI1_ECOLX, A0A074IAX5_ECOLX, A0A080GBB4_ECOLX, A0A0E0TTK7_ECOLX, A0A0E0Y4V8_ECO1C, A0A0E1SSY5_ECOLX, A0A0H3PHB8_ECO5C, A0A170UYG5_KLEOX, A0A1X3IBM1_ECOLX, A0A1X3J5C3_ECOLX, A0A1X3JLW6_ECOLX, A0A1X3L786_ECOLX, A0A1X3LM59_ECOLX, A0A1Z3UUT6_ECOLX, A0A222QFD4_ECOLX, A0A237LE06_SHIBO, A0A365Q4M2_ECOLX, A0A3D8XNL5_9ENTR, A0A4S5ATD4_ECOLI, A0A557R434_ECOLX, A0A5B7MV49_ECOLX, A0A6C8HNY4_ECOLX, A0A6H2GIT7_9ESCH, A0A6I4KHM9_9ENTR, A0A7M3S2F6_ECOHS, A0A7U8MRF1_ECO57, A7ZHX3_ECO24, B6HZU9_ECOSE, B7LHE1_ECO55, C8UH93_ECO1A, D3QWN1_ECOCB, D6HSD9_ECOLX, D6I5D3_ECOLX, D7XRD3_ECOLX, D7ZKQ6_ECOLX, D8E9U8_ECOLX, E0J653_ECOLW, E1IYR3_ECOLX, E1JBS7_ECOLX, E6BQG9_ECOLX, E9TA15_ECOLX, E9XQ91_ECOLX, F0JUI5_ESCFE, F4TA69_ECOLX, F4VA08_ECOLX, I2UQJ1_ECOLX, I2W5C5_ECOLX, I2WRX5_ECOLX, K4V6C9_ECOLX, L3QI00_ECOLX, O52671_ECOLX, Q7DC35_ECO57, T9TKR2_ECOLX, U9YQY4_ECOLX, U9YRG6_ECOLX, V0YIY8_ECOLX, V6FS32_ECOLX, V8K7E2_ECOLX, W1EQY6_ECOLX
KEGG ID ecw:EcE24377A_0243, elw:ECW_m0233, eoi:ECO111_0235, eck:EC55989_0235, ecs:ECs0234, ece:Z0266, esl:O3K_20405, ecy:ECSE_0232, eok:G2583_0242, eun:UMNK88_244
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 5e-32 8..155

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
- -



  Protein sequence: 173 a.a.    

>T6CP008835 NC_013364:261961-262479 [Escherichia coli O111:H- str. 11128] [TssD]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPL
MYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGT
SGADDWRAPLEA*

  Nucleotide sequence: 519 bp    

>T6CP008835 NC_013364:261961-262479 [Escherichia coli O111:H- str. 11128] [TssD]
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCGCTGATTCTGT
CGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAACGTTACTGTCCCGACCGATC
CTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTTACCGTGGCGCTGAACAAAGCGGTTCCGCTG
ATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCACTGAACTTCACTGGTGGCGTACCTCTGTGGAAGGCAAACA
GGAGCATTATTTCACTACCCGCCTGACTGATTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGG
CGAAACGCGAGTTCACCCAGTTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACC
TCCGGTGCCGACGACTGGCGCGCACCGCTGGAAGCATAA