Detailed information of component protein


Summary

Component ID T6CP008465
Component protein type TssE
T6SS ID (Type) T6SS00113 experimental (Type i1)
Strain Burkholderia thailandensis E264
Replicon chromosome II
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
[1] Russell AB, Singh P, Brittnacher M, et al. A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 2012 May 17;11(5):538-49. doi: 10.1016/j.chom.2012.04.007. PMID: 22607806
[2] Schwarz S, West TE, Boyer F, et al. Burkholderia type VI secretion systems have distinct roles in eukaryotic and bacterial cell interactions. PLoS Pathog. 2010 Aug 26;6(8):e1001068. doi: 10.1371/journal.ppat.1001068. PMID: 20865170
[3] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068
[4] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
[5] Schwarz S, Singh P, Robertson JD, et al. VgrG-5 is a Burkholderia type VI secretion system-exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 2014 Apr;82(4):1445-52. doi: 10.1128/IAI.01368-13. Epub 2014 Jan 22. PMID: 24452686
[6] Lennings J, Makhlouf M, Olejnik P, et al. Environmental and cellular factors affecting the localization of T6SS proteins in Burkholderia thailandensis. Int J Med Microbiol. 2019 Sep;309(6):151335. doi: 10.1016/j.ijmm.2019.151335. Epub 2019 Jul 18. PMID: 31378704
[7] Lennings J, Mayer C, Makhlouf M, et al. Polar localization of the ATPase ClpV-5 occurs independent of type VI secretion system apparatus proteins in Burkholderia thailandensis. BMC Res Notes. 2019 Feb 28;12(1):109. doi: 10.1186/s13104-019-4141-3. PMID: 30819219
[8] Lennings J, West TE, Schwarz S. The Burkholderia Type VI Secretion System 5: Composition, Regulation and Role in Virulence. Front Microbiol. 2019 Jan 10;9:3339. doi: 10.3389/fmicb.2018.03339. eCollection 2018. PMID: 30687298
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) BTH_RS04500
Coordinate (Strand) 1018142..1018618 (-)
NCBI ID WP_009896194.1
RefSeq NC_007650
Uniprot ID UPI00006677DC
KEGG ID -
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 4.5e-16 45..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MARAEGVSARLPARAPARAPSGERRLLERIADREAGGERSPSADALARSIIDHLRRILNTRQGHVPIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVIACYEPRLKSPRVTLAERALDAATLHFSLDARLVLDAREVPARFLTTVSGNGKIDIRTIS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9328 - -



  Protein sequence: 159 a.a.    

>T6CP008465 NC_007650:c1018618-1018142 [Burkholderia thailandensis E264] [TssE]
MARAEGVSARLPARAPARAPSGERRLLERIADREAGGERSPSADALARSIIDHLRRILNTRQGHVPIDPAFGVPDFTNLA
GGFAQGSAREIEAQIERVIACYEPRLKSPRVTLAERALDAATLHFSLDARLVLDAREVPARFLTTVSGNGKIDIRTIS*

  Nucleotide sequence: 477 bp    

>T6CP008465 NC_007650:c1018618-1018142 [Burkholderia thailandensis E264] [TssE]
ATGGCGCGCGCCGAAGGTGTGAGCGCCCGCCTGCCGGCGCGCGCGCCCGCCCGCGCGCCGTCGGGCGAGCGCCGGCTGCT
CGAGCGGATCGCGGACCGTGAAGCGGGCGGCGAGCGCTCGCCGTCCGCCGACGCGCTCGCGCGCTCGATCATCGATCATC
TTCGCCGCATCCTGAACACGCGGCAAGGCCACGTGCCGATCGATCCGGCCTTCGGCGTGCCGGACTTCACGAATCTCGCG
GGCGGCTTCGCGCAAGGCTCCGCCCGCGAGATCGAGGCGCAGATCGAGCGCGTGATCGCGTGCTACGAGCCGCGGCTGAA
ATCGCCGCGCGTCACGCTCGCCGAGCGGGCGCTCGACGCGGCGACGCTGCACTTCAGTCTCGACGCGCGGCTCGTGCTCG
ACGCGCGCGAAGTTCCGGCGCGCTTCCTGACGACTGTCAGCGGCAACGGAAAGATCGATATCCGAACCATTTCCTGA