Detailed information of component protein

Summary

Component ID	T6CP008440
Component protein type	TssD
T6SS ID (Type)	T6SS00075 (Type i1)
Strain	Burkholderia pseudomallei K96243
Replicon	chromosome II
Sequence	Protein sequence (170 a.a.); Nucleotide sequence (510 bp)
Reference	[1] Burtnick MN, Brett PJ, Harding SV, et al. The cluster 1 type VI secretion system is a major virulence determinant in Burkholderia pseudomallei. Infect Immun. 2011 Apr;79(4):1512-25. doi: 10.1128/IAI.01218-10. Epub 2011 Feb 7. PMID: 21300775 [2] Shalom G, Shaw JG, Thomas MS. In vivo expression technology identifies a type VI secretion system locus in Burkholderia pseudomallei that is induced upon invasion of macrophages. Microbiology (Reading). 2007 Aug;153(Pt 8):2689-2699. doi: 10.1099/mic.0.2007/006585-0. PMID: 17660433 [3] Chen Y, Wong J, Sun GW, et al. Regulation of type VI secretion system during Burkholderia pseudomallei infection. Infect Immun. 2011 Aug;79(8):3064-73. doi: 10.1128/IAI.05148-11. Epub 2011 Jun 13. PMID: 21670170 [4] Fisher NA, Ribot WJ, Applefeld W, et al. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis. BMC Microbiol. 2012 Jun 22;12:117. doi: 10.1186/1471-2180-12-117. PMID: 22892068 [5] Sun GW, Chen Y, Liu Y, et al. Identification of a regulatory cascade controlling Type III Secretion System 3 gene expression in Burkholderia pseudomallei. Mol Microbiol. 2010 May;76(3):677-89. doi: 10.1111/j.1365-2958.2010.07124.x. Epub 2010 Mar 24. PMID: 20345664 [6] Toesca IJ, French CT, Miller JF. The Type VI secretion system spike protein VgrG5 mediates membrane fusion during intercellular spread by pseudomallei group Burkholderia species. Infect Immun. 2014 Apr;82(4):1436-44. doi: 10.1128/IAI.01367-13. Epub 2014 Jan 13. PMID: 24421040 [7] Hopf V, Göhler A, Eske-Pogodda K, et al. BPSS1504, a cluster 1 type VI secretion gene, is involved in intracellular survival and virulence of Burkholderia pseudomallei. Infect Immun. 2014 May;82(5):2006-15. doi: 10.1128/IAI.01544-14. Epub 2014 Mar 4. PMID: 24595140 [8] Chen Y, Schröder I, French CT, et al. Characterization and analysis of the Burkholderia pseudomallei BsaN virulence regulon. BMC Microbiol. 2014 Aug 1;14:206. doi: 10.1186/s12866-014-0206-6. PMID: 25085508 [9] Chirakul S, Bartpho T, Wongsurawat T, et al. Characterization of BPSS1521 (bprD), a regulator of Burkholderia pseudomallei virulence gene expression in the mouse model. PLoS One. 2014 Aug 11;9(8):e104313. doi: 10.1371/journal.pone.0104313. eCollection 2014. PMID: 25111708 [10] Chen Y, Schröder I, French CT, et al. Characterization and analysis of the Burkholderia pseudomallei BsaN virulence regulon. BMC Microbiol. 2014 Aug 1;14:206. doi: 10.1186/s12866-014-0206-6. PMID: 25085508

Experimental investigation has been performed on this T6SS

---

External database links

Locus tag (Gene)	BPS_RS26895
Coordinate (Strand)	2043052..2043561 (+)
NCBI ID	WP_004525344.1
RefSeq	NC_006351
Uniprot ID	A0A0F6L0M6_BURPE, Q63K67_BURPS, G4XEK9_BURPE, A0A0E1VQX4_BURPE, Q3JL59_BURP1, A3NL98_BURP6, B1H8I5_BURPE, A3P6V0_BURP0, A8EPP9_BURPE, A0A0E1S572_BURPE, C4I6G0_BURPE, A0A0E1TUW6_BURPE, A0A0E1UNC9_BURPE, A0A0H3HVA0_BURP2
KEGG ID	but:X994_5617, bps:BPSS1498, bpz:BP1026B_II1591, bpd:BURPS668_A2125, bpm:BURPS1710b_A0535, bpl:BURPS1106A_A2027
PDB ID	3WX6

---

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region
T6SS_HCP	PF05638.14	4.5e-23	6..155

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-169	MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGYIEEIKFTYSGYSLEHAESGIAGAANWTNG

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
Other	0.9812	-	-

---

  Protein sequence: 170 a.a.    Download


  Nucleotide sequence: 510 bp    Download