Detailed information of component protein


Summary

Component ID T6CP008429
Component protein type TssE
T6SS ID (Type) T6SS00043 experimental (Type i1)
Strain Vibrio parahaemolyticus RIMD 2210633
Replicon chromosome I
Sequence Protein sequence (137 a.a.); Nucleotide sequence (411 bp)
Reference
[1] Ma L, Zhang Y, Yan X, et al. Expression of the type VI secretion system 1 component Hcp1 is indirectly repressed by OpaR in Vibrio parahaemolyticus. ScientificWorldJournal. 2012;2012:982140. doi: 10.1100/2012/982140. Epub 2012 Jul 31. PMID: 22924031
[2] Yu Y, Yang H, Li J, et al. Putative type VI secretion systems of Vibrio parahaemolyticus contribute to adhesion to cultured cell monolayers. Arch Microbiol. 2012 Oct;194(10):827-35. Epub 2012 Apr 26. PMID: 22535222
[3] Salomon D, Gonzalez H, Updegraff BL, et al. Vibrio parahaemolyticus type VI secretion system 1 is activated in marine conditions to target bacteria, and is differentially regulated from system 2. PLoS One. 2013 Apr 16;8(4):e61086. doi: 10.1371/journal.pone.0061086. Print 2013. PMID: 23613791
[4] Boyer F, Fichant G, Berthod J, et al. Dissecting the bacterial type VI secretion system by a genome wide in silico analysis: what can be learned from available microbial genomic resources? BMC Genomics. 2009 Mar 12;10:104. doi: 10.1186/1471-2164-10-104. PMID: 19284603
[5] Salomon D, Kinch LN, Trudgian DC, et al. Marker for type VI secretion system effectors. Proc Natl Acad Sci U S A. 2014 Jun 24;111(25):9271-6. doi: 10.1073/pnas.1406110111. Epub 2014 Jun 9. PMID: 24927539
[6] Salomon D, Klimko JA, Orth K. H-NS regulates the Vibrio parahaemolyticus type VI secretion system 1. Microbiology (Reading). 2014 Sep;160(Pt 9):1867-1873. doi: 10.1099/mic.0.080028-0. Epub 2014 Jul 1. PMID: 24987102
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene)
Coordinate (Strand) 1508337..1508747 (+)
NCBI ID WP_005480585.1
RefSeq NC_004603
Uniprot ID A0A072J844_VIBPH
KEGG ID -
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-136 MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHLHLADLLNTHSGNAMIDSEYGLPDFNDVLSNNTNLVRHIQKNITATIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9954 - -


  Protein sequence: 137 a.a.    


  Nucleotide sequence: 411 bp