Detailed information of component protein


Summary

Component ID T6CP008374
Component protein type TssE
T6SS ID (Type) T6SS00002 experimental (Type i1)
Strain Vibrio cholerae O1 biovar El Tor str. N16961
Replicon chromosome II (Vas)
Sequence Protein sequence (146 a.a.); Nucleotide sequence (438 bp)
Reference
[1] Unterweger D, Kitaoka M, Miyata ST, et al. Constitutive type VI secretion system expression gives Vibrio cholerae intra- and interspecific competitive advantages. PLoS One. 2012;7(10):e48320. doi: 10.1371/journal.pone.0048320. Epub 2012 Oct 26. PMID: 23110230
[2] Basler M, Pilhofer M, Henderson GP, et al. Type VI secretion requires a dynamic contractile phage tail-like structure. Nature. 2012 Feb 26;483(7388):182-6. doi: 10.1038/nature10846. PMID: 22367545
[3] Ishikawa T, Sabharwal D, Bröms J, et al. Pathoadaptive conditional regulation of the type VI secretion system in Vibrio cholerae O1 strains. Infect Immun. 2012 Feb;80(2):575-84. doi: 10.1128/IAI.05510-11. Epub 2011 Nov 14. PMID: 22083711
[4] Kitaoka M, Miyata ST, Brooks TM, et al. VasH is a transcriptional regulator of the type VI secretion system functional in endemic and pandemic Vibrio cholerae. J Bacteriol. 2011 Dec;193(23):6471-82. doi: 10.1128/JB.05414-11. Epub 2011 Sep 23. PMID: 21949076
[5] Zheng J, Ho B, Mekalanos JJ. Genetic analysis of anti-amoebae and anti-bacterial activities of the type VI secretion system in Vibrio cholerae. PLoS One. 2011;6(8):e23876. doi: 10.1371/journal.pone.0023876. Epub 2011 Aug 31. PMID: 21909372
[6] Pietrosiuk A, Lenherr ED, Falk S, et al. Molecular basis for the unique role of the AAA+ chaperone ClpV in type VI protein secretion. J Biol Chem. 2011 Aug 26;286(34):30010-21. doi: 10.1074/jbc.M111.253377. Epub 2011 Jul 5. PMID: 21733841
[7] Miyata ST, Kitaoka M, Brooks TM, et al. Vibrio cholerae requires the type VI secretion system virulence factor VasX to kill Dictyostelium discoideum. Infect Immun. 2011 Jul;79(7):2941-9. doi: 10.1128/IAI.01266-10. Epub 2011 May 9. PMID: 21555399
[8] Records AR. The type VI secretion system: a multipurpose delivery system with a phage-like machinery. Mol Plant Microbe Interact. 2011 Jul;24(7):751-7. doi: 10.1094/MPMI-11-10-0262. PMID: 21361789
[9] Kitaoka M, Miyata ST, Unterweger D, et al. Antibiotic resistance mechanisms of Vibrio cholerae. J Med Microbiol. 2011 Apr;60(Pt 4):397-407. doi: 10.1099/jmm.0.023051-0. Epub 2011 Jan 20. PMID: 21252269
[10] MacIntyre DL, Miyata ST, Kitaoka M, et al. The Vibrio cholerae type VI secretion system displays antimicrobial properties. Proc Natl Acad Sci U S A. 2010 Nov 9;107(45):19520-4. doi: 10.1073/pnas.1012931107. Epub 2010 Oct 25. PMID: 20974937
[11] Pukatzki S, Ma AT, Sturtevant D, et al. Identification of a conserved bacterial protein secretion system in Vibrio cholerae using the Dictyostelium host model system. Proc Natl Acad Sci U S A. 2006 Jan 31;103(5):1528-33. Epub 2006 Jan 23. PMID: 16432199
[12] Pukatzki S, Ma AT, Revel AT, et al. Type VI secretion system translocates a phage tail spike-like protein into target cells where it cross-links actin. Proc Natl Acad Sci U S A. 2007 Sep 25;104(39):15508-13. Epub 2007 Sep 14. PMID: 17873062
[13] Ma AT, McAuley S, Pukatzki S, et al. Translocation of a Vibrio cholerae type VI secretion effector requires bacterial endocytosis by host cells. Cell Host Microbe. 2009 Mar 19;5(3):234-43. doi: 10.1016/j.chom.2009.02.005. PMID: 19286133
[14] Dong TG, Mekalanos JJ. Characterization of the RpoN regulon reveals differential regulation of T6SS and new flagellar operons in Vibrio cholerae O37 strain V52. Nucleic Acids Res. 2012 Sep;40(16):7766-75. doi: 10.1093/nar/gks567. Epub 2012 Jun 20. PMID: 22723378
[15] Dong TG, Ho BT, Yoder-Himes DR, et al. Identification of T6SS-dependent effector and immunity proteins by Tn-seq in Vibrio cholerae. Proc Natl Acad Sci U S A. 2013 Feb 12;110(7):2623-8. doi: 10.1073/pnas.1222783110. Epub 2013 Jan 29. PMID: 23362380
[16] Russell AB, LeRoux M, Hathazi K, et al. Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 2013 Apr 25;496(7446):508-12. doi: 10.1038/nature12074. Epub 2013 Apr 3. PMID: 23552891
[17] Bröms JE, Ishikawa T, Wai SN, et al. A functional VipA-VipB interaction is required for the type VI secretion system activity of Vibrio cholerae O1 strain A1552. BMC Microbiol. 2013 May 3;13:96. doi: 10.1186/1471-2180-13-96. PMID: 23642157
[18] Miyata ST, Unterweger D, Rudko SP, et al. Dual expression profile of type VI secretion system immunity genes protects pandemic Vibrio cholerae. PLoS Pathog. 2013;9(12):e1003752. doi: 10.1371/journal.ppat.1003752. Epub 2013 Dec 5. PMID: 24348240
[19] Shao Y, Bassler BL. Quorum regulatory small RNAs repress type VI secretion in Vibrio cholerae. Mol Microbiol. 2014 Jun;92(5):921-30. doi: 10.1111/mmi.12599. Epub 2014 Apr 24. PMID: 24698180
[20] Yang X, Xu M, Wang Y, et al. Molecular mechanism for self-protection against the type VI secretion system in Vibrio cholerae. Acta Crystallogr D Biol Crystallogr. 2014 Apr;70(Pt 4):1094-103. doi: 10.1107/S1399004714001242. Epub 2014 Mar 20. PMID: 24699653
[21] Jeong JH, Chang JH, Kim YG. Purification, crystallization and preliminary X-ray crystallographic analysis of TssL from Vibrio cholerae. Acta Crystallogr F Struct Biol Commun. 2014 Sep;70(Pt 9):1260-3. doi: 10.1107/S2053230X14017397. Epub 2014 Aug 27. PMID: 25195905
[22] Borgeaud S, Metzger LC, Scrignari T, et al. The type VI secretion system of Vibrio cholerae fosters horizontal gene transfer. Science. 2015 Jan 2;347(6217):63-7. doi: 10.1126/science.1260064. PMID: 25554784
[23] Altindis E, Dong T, Catalano C, et al. Secretome analysis of Vibrio cholerae type VI secretion system reveals a new effector-immunity pair. mBio. 2015 Mar 10;6(2):e00075. doi: 10.1128/mBio.00075-15. PMID: 25759499
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VC_RS13890
Coordinate (Strand) 118874..119311 (+)
NCBI ID WP_000221000.1
RefSeq NC_002506
Uniprot ID Q9KN56_VIBCH, A0A0X1L1X4_VIBCO, D7HAV1_VIBCL, A0A0K9UXR3_VIBCL, A0A7U8ZRF7_VIBCL, A0A0H3Q272_VIBCL, C3LUD3_VIBCM, A0A023PTG3_VIBCL
KEGG ID vch:VCA0109, vcm:VCM66_A0107, vcq:EN18_04270, vcx:VAA049_1799, vcz:VAB027_920
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 3e-17 38..124

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-145 MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSRKYRVF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9889 - -



  Protein sequence: 146 a.a.    

>T6CP008374 NC_002506:118874-119311 [Vibrio cholerae O1 biovar El Tor str. N16961] [TssE]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDATLETLDLSVR
IKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSRKYRVF*

  Nucleotide sequence: 438 bp    

>T6CP008374 NC_002506:118874-119311 [Vibrio cholerae O1 biovar El Tor str. N16961] [TssE]
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCAAACCTATGTC
GCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAACATTCTGAACACTCGAATTG
GTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCAACGCTGGAAACCTTAGATCTCTCCGTGCGA
ATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGCCGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAG
CTTTAACCCGCTGACTTTAAGGTTCCACATTACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTC
TGTTATTGGATCAAAGCAGAAAATATCGAGTGTTTTAA