Detailed information of component protein


Summary

Component ID T6CP008075
Component protein type TssG
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (351 a.a.); Nucleotide sequence (1053 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30175
Coordinate (Strand) 6712843..6713895 (+)
NCBI ID WP_011064260.1
RefSeq NC_021237
Uniprot ID Q4K3N3_PSEF5
KEGG ID pfl:PFL_6092
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 8.9e-107 21..319

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-350 MESQARTSSDSLNTLTAMHAEPWEYDFFQALRRIECLSPQLPRFGHSVRLADDPLRLGQQADCSFAPATLASVTPGSDGAATRLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSARLAALSGRGMPSLLKQGLIADTAKLHYSGHLAAQTRYPDGLRAIISEYFGLPVQIEEYVGQWLELPERSRVGVQSHQLGVDFCLGSHVWDRQHKFRIRLGPMKLDDYLGMLPDGQQFQELVAWAAEYLGFELDWDLNLVLLKDEVPKLQLNGRQRLGFNTWLGQPGSDAKDLILARHYADLATTSRTPRSTEHG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9854 - -



  Protein sequence: 351 a.a.    

>T6CP008075 NC_021237:6712843-6713895 [Pseudomonas protegens CHA0] [TssG]
MESQARTSSDSLNTLTAMHAEPWEYDFFQALRRIECLSPQLPRFGHSVRLADDPLRLGQQADCSFAPATLASVTPGSDGA
ATRLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSARLAA
LSGRGMPSLLKQGLIADTAKLHYSGHLAAQTRYPDGLRAIISEYFGLPVQIEEYVGQWLELPERSRVGVQSHQLGVDFCL
GSHVWDRQHKFRIRLGPMKLDDYLGMLPDGQQFQELVAWAAEYLGFELDWDLNLVLLKDEVPKLQLNGRQRLGFNTWLGQ
PGSDAKDLILARHYADLATTSRTPRSTEHG*

  Nucleotide sequence: 1053 bp    

>T6CP008075 NC_021237:6712843-6713895 [Pseudomonas protegens CHA0] [TssG]
ATGGAAAGCCAAGCCCGGACGTCGTCCGACTCTTTGAATACGCTGACGGCGATGCACGCCGAGCCTTGGGAGTACGACTT
CTTCCAGGCCCTGCGGCGTATCGAATGCCTGTCGCCGCAACTGCCGCGCTTCGGTCACTCCGTGCGCCTGGCGGACGATC
CGCTGCGCCTGGGACAGCAGGCCGACTGCAGCTTCGCCCCGGCCACCCTGGCCTCGGTCACCCCCGGCAGCGACGGCGCC
GCGACCCGCCTGGAGCAGTTCTTCTTCGGCCTCGGCGGGCCCAACGGGCCGTTGCCGCTGCACATCACCGAATACGTGCG
CGAGCGCCAGCGCAACAACGCCGACAGCACCAGCAAGCGCTTTCTCGATGTGTTCCACCACCGCCTGCTGAGCCTGTTCT
ATCGGGCCTGGGCCGAAGCCCGACCGACGGTGAGCCACGATCGCCCGGACGACGACTACTGGTCGGCGCGGCTGGCGGCG
CTGTCGGGCCGGGGCATGCCCAGCCTGCTCAAGCAGGGTCTGATAGCCGACACCGCCAAGCTGCATTACAGCGGCCACCT
GGCGGCCCAGACCCGCTACCCGGACGGCTTGCGGGCGATCATCAGCGAGTATTTCGGCCTGCCGGTGCAGATCGAGGAAT
ATGTCGGCCAGTGGCTGGAGTTGCCCGAACGCAGCCGGGTCGGGGTGCAATCCCATCAGCTGGGGGTGGATTTCTGCCTG
GGCAGCCACGTCTGGGACCGCCAGCACAAGTTCCGCATCCGCCTCGGCCCGATGAAACTGGACGACTACCTGGGGATGCT
GCCCGACGGCCAGCAATTCCAGGAACTGGTGGCCTGGGCCGCCGAATACCTGGGCTTCGAGCTGGACTGGGACCTGAACC
TGGTCCTGCTCAAGGACGAAGTGCCCAAGCTGCAACTCAACGGCCGCCAGCGCCTGGGTTTCAACACCTGGCTCGGCCAA
CCCGGCAGCGATGCCAAGGATCTAATACTGGCCCGGCACTACGCCGACCTGGCCACTACCTCACGTACACCAAGGAGCAC
AGAGCATGGGTGA