Detailed information of component protein


Summary

Component ID T6CP008074
Component protein type TssF
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (620 a.a.); Nucleotide sequence (1860 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30170
Coordinate (Strand) 6711020..6712879 (+)
NCBI ID WP_011064259.1
RefSeq NC_021237
Uniprot ID A0A2C9EWE0_PSEPH, Q4K3N4_PSEF5
KEGG ID pfl:PFL_6091, pprc:PFLCHA0_c60500
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 2.7e-231 1..616

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-619 MNPRLLELYNQELHHVRESAAEFAKEFPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFTLERDTSLRAALGRDTQTCCEYRTAHSVTLWPLQVAQAEYFGNPSAVLGRLAASEPRAKAGLRLTLRTGAELPFNSLALDELPLYLNGNDEQPFRLYEQLLGNVCAVFARAPGGDWVERLPPDALRSRGFDDRDAALPVVPQAFQGYRLLQEYFALPNRFLFVEFAQLGRAVQRCAGQELELIVLFERFDQSLEGSVGTAQFVPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFEVHSLTAISGHGTGPEQPFLPFYAVRDPSRYGRDQSYYIVRREPRVLSSDQRRNGPRSTYIGSESFVSLVDSQQAPYRHDLRQLGVSALCTNRDLPLFMNTGNGKTDFTLADSAPVQAIRCLAGPSRPRPSHAHDGKAWRLISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEITLEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9920 - -



  Protein sequence: 620 a.a.    

>T6CP008074 NC_021237:6711020-6712879 [Pseudomonas protegens CHA0] [TssF]
MNPRLLELYNQELHHVRESAAEFAKEFPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAY
PHYLAPTPSMTVVQLQADPDEGSLSSGFTLERDTSLRAALGRDTQTCCEYRTAHSVTLWPLQVAQAEYFGNPSAVLGRLA
ASEPRAKAGLRLTLRTGAELPFNSLALDELPLYLNGNDEQPFRLYEQLLGNVCAVFARAPGGDWVERLPPDALRSRGFDD
RDAALPVVPQAFQGYRLLQEYFALPNRFLFVEFAQLGRAVQRCAGQELELIVLFERFDQSLEGSVGTAQFVPFCTPAINL
FPKRLDRIHLSDRVNEHHVIADRTRPMDFEVHSLTAISGHGTGPEQPFLPFYAVRDPSRYGRDQSYYIVRREPRVLSSDQ
RRNGPRSTYIGSESFVSLVDSQQAPYRHDLRQLGVSALCTNRDLPLFMNTGNGKTDFTLADSAPVQAIRCLAGPSRPRPS
HAHDGKAWRLISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL*

  Nucleotide sequence: 1860 bp    

>T6CP008074 NC_021237:6711020-6712879 [Pseudomonas protegens CHA0] [TssF]
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCGGAGTTCGCCAAGGAATT
CCCGAAGATCGCCAGCCGCCTGACCCTGTCGGGCATGGACTGCGCCGACCCCTATGTCGAGCGCCTGCTGGAGGGCTTCG
CCTACCTGACTGCCCGGGTGCAGCTCAAGCTCGACGCCGAGTACCCGACCTTCACCCACAACCTGCTGGAGATCGCCTAC
CCGCACTACCTGGCACCGACCCCGTCGATGACCGTGGTGCAGTTGCAGGCCGATCCCGACGAAGGTTCCCTGAGCAGCGG
CTTCACCCTGGAGCGCGACACCAGCCTGCGCGCCGCCCTGGGCCGCGATACCCAGACCTGCTGCGAATACCGCACCGCGC
ACTCGGTGACCCTGTGGCCACTGCAAGTGGCCCAGGCCGAATACTTCGGCAACCCGTCGGCAGTGCTCGGGCGCCTGGCC
GCCAGCGAGCCCAGGGCCAAGGCCGGGCTGCGCCTGACCCTGCGCACCGGCGCCGAACTGCCGTTCAACAGCCTGGCCCT
GGACGAGTTGCCGCTGTACCTGAACGGCAATGACGAACAGCCGTTCCGCCTCTACGAACAACTGCTGGGCAACGTCTGCG
CGGTGTTCGCCCGGGCCCCGGGCGGCGACTGGGTCGAGCGCCTGCCCCCGGACGCCCTGCGCTCGCGCGGTTTCGACGAC
CGCGACGCGGCGCTGCCGGTGGTGCCCCAGGCCTTCCAGGGCTACCGCCTGCTGCAGGAATACTTCGCCCTGCCCAACCG
CTTCCTGTTCGTCGAATTCGCCCAGCTGGGGCGCGCGGTCCAGCGCTGCGCCGGCCAGGAGCTGGAGCTGATCGTGCTCT
TCGAGCGCTTCGACCAGAGCCTGGAAGGCAGCGTCGGCACCGCTCAGTTCGTGCCCTTCTGCACCCCGGCGATCAACCTG
TTTCCCAAGCGCCTGGACCGTATCCACCTGTCCGACCGGGTCAACGAGCACCATGTGATCGCCGACCGCACCCGACCGAT
GGATTTCGAGGTCCACTCGCTGACCGCCATCAGCGGCCACGGCACCGGCCCGGAACAGCCGTTCCTGCCGTTCTACGCCG
TGCGCGATCCATCCCGCTACGGCCGCGACCAGTCCTACTACATCGTCCGGCGCGAGCCGCGGGTGCTGTCCAGCGACCAG
CGTCGCAACGGCCCGCGCTCCACCTACATCGGCAGCGAATCCTTCGTCAGCCTGGTGGACAGCCAGCAGGCGCCCTATCG
CCACGACCTGCGCCAGCTCGGGGTCAGCGCGCTGTGCACCAACCGCGACCTGCCACTGTTCATGAACACCGGCAACGGCA
AGACCGACTTCACCCTGGCCGACAGCGCCCCGGTACAGGCCATCCGCTGCCTGGCGGGCCCGAGCCGGCCGCGCCCCAGC
CATGCCCACGACGGCAAGGCCTGGCGCCTGATCAGCCAGCTATCGCTGAACTACCTGTCCCTGAGCGAACAGGGCCAGGG
CGCGGCGGCCCTGCGCGAACTGCTGCGGTTGTACGGCGACAGCAACGACGCGGCCCTGCAGTTGCAGATCGAGGGCCTGC
GGGAAGTCAGCAGCAAGGCGGTGACCCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGGGGCCTGGAGATCACC
CTGGAGTTCGATGAAAACGCGTTCCGCGGCACCGGGGTGTTTCTGCTCGGCGCGGTATTCGAGCGCTTCCTGGCACGTTA
TGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCATGCGATGGAAAGCCAAGCCCG
GACGTCGTCCGACTCTTTGA