Detailed information of component protein


Summary

Component ID T6CP008071
Component protein type TssC
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (498 a.a.); Nucleotide sequence (1494 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30155
Coordinate (Strand) 6708247..6709740 (+)
NCBI ID WP_011064256.1
RefSeq NC_021237
Uniprot ID A0A2C9EVT9_PSEPH, Q4K3N7_PSEF5, A0A7U9LBI8_PSEFL
KEGG ID pprc:PFLCHA0_c60470, pfl:PFL_6088
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 2.7e-136 68..370
VipB_2 PF18945.2 3.1e-43 380..491

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-497 MTELMRDNQAQPGATEQASEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESIIAAIDAKLTAQVNQVIHHPEFQKLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTAWDQSPLFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWANAAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKGA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9907 - -



  Protein sequence: 498 a.a.    

>T6CP008071 NC_021237:6708247-6709740 [Pseudomonas protegens CHA0] [TssC]
MTELMRDNQAQPGATEQASEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESIIAAIDAKLTAQ
VNQVIHHPEFQKLESAWRGLHYLVNNTETDEQLKIRVLNISKPELHKTLKKFKGTAWDQSPLFKKMYEEEYGQFGGEPYG
CLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIG
LTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWANAAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFP
TDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFA
HYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLEG
LTVSLRLVSKLPSAKGA*

  Nucleotide sequence: 1494 bp    

>T6CP008071 NC_021237:6708247-6709740 [Pseudomonas protegens CHA0] [TssC]
ATGACCGAATTGATGCGTGACAATCAGGCGCAACCCGGCGCCACCGAGCAGGCCAGCGAATTCGCATCGCTGCTGCTGCA
GGAATTCAAGCCCAAGACCGAGCGTGCTCGCGAAGCCGTGGAAACCGCGGTGCGGACCCTGGCCGAACAGGCCCTGGCGC
AGACCGACCTGGTGTCCAACGACGCCATCAAGTCGATCGAGTCGATCATCGCCGCCATCGACGCCAAGCTCACCGCCCAG
GTCAACCAGGTGATCCATCACCCGGAATTCCAGAAGCTGGAAAGCGCCTGGCGCGGCCTGCACTACCTGGTGAACAACAC
CGAGACCGACGAGCAGCTCAAGATCCGCGTGCTCAACATCTCCAAGCCGGAGCTGCACAAGACCCTGAAGAAATTCAAGG
GCACGGCCTGGGACCAGAGCCCGCTCTTCAAGAAGATGTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCTTACGGC
TGCCTGGTGGGCGACTACTACTTCGACCAGTCGCCACCGGATGTCGAGCTGCTGGGCGAGCTGTCCAAGGTTTGCGCCGC
CATGCACTCGCCGTTCATCGCCGCGGCTTCGCCGACCGTGATGGGCATGGGCTCGTGGCAGGAACTGTCGAACCCGCGCG
ACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGTTGCGTGAATCGGAAGACTCGCGCTACATCGGC
CTGACCATGCCGCGCTTCCTGGCGCGCCTGCCATACGGCGCCAAGACCGACCCGGTGGAAGCCTTCGCCTTCGAGGAAAA
CACCGACGGCGCCGACAGCTCCAAGTACACCTGGGCCAACGCCGCCTACGCCATGGCCGTGAACATCAACCGTTCGTTCA
AGCATTTCGGCTGGTGCTCGCGGATCCGCGGCGTGGAGTCCGGCGGCGAGGTGGAAAACCTCCCGGCCCACACCTTCCCC
ACCGACGACGGTGGCGTGGACATGAAGTGCCCGACCGAGATCGCCATCTCCGACCGTCGTGAAGCGGAACTGGCGAAGAA
CGGCTTCATGCCACTGCTGCACAAGAAGAACACCGACTTCGCCGCCTTCATCGGCGCCCAGTCGCTGCAGAAGCCGGCCG
AATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTTCGCCACTTGCCGCTTCGCT
CACTACTTGAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCAAAGAGAAGGACGAGATGCAGCGCTGGTTGCAGGACTG
GATCCTCAACTACGTCGACGGTGATCCGGCGCACTCCACCGAAACCACCAAGGCCCAGCACCCACTGGCCGCGGCGGAAG
TGGTGGTCGAGGAAGTCGAAGGCAACCCCGGCTACTACAACTCGAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGG
CTGACCGTGTCGTTGCGCCTGGTATCCAAACTGCCGTCCGCCAAGGGCGCCTAA