Detailed information of component protein


Summary

Component ID T6CP008070
Component protein type TssB
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (172 a.a.); Nucleotide sequence (516 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30150
Coordinate (Strand) 6707715..6708230 (+)
NCBI ID WP_011064255.1
RefSeq NC_021237
Uniprot ID A0A2C9EVT5_PSEPH, Q4K3N8_PSEF5, A0A7U9LBS9_PSEFL
KEGG ID pfl:PFL_6087, pprc:PFLCHA0_c60460
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 1.2e-56 11..161

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-171 VAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPVEPLAAVADRKFLEIDVDNFDSRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTGAEEIIMKAIKDPALLQALASAPKPADSEPNA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9958 - -



  Protein sequence: 172 a.a.    

>T6CP008070 NC_021237:6707715-6708230 [Pseudomonas protegens CHA0] [TssB]
VAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPVEPLAAVADRKFLEIDVDNFDSRLKAMQPRV
AFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTGAEEIIMKAIKDPALLQALAS
APKPADSEPNA*

  Nucleotide sequence: 516 bp    

>T6CP008070 NC_021237:6707715-6708230 [Pseudomonas protegens CHA0] [TssB]
GTGGCGAAGCAAAGTTCTCAAAAGTTCATCGCGCGCAACCGCGCGCCCCGGGTGCAGATCGAGTACGACGTCGAACTCTA
CGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTCATGGGCGTGATGGCCGACCTCGCCGGCAAGCCCGTGGAGCCCCTGG
CGGCCGTGGCCGATCGCAAGTTCCTGGAAATCGACGTCGATAACTTCGACTCGCGCCTCAAGGCCATGCAGCCTCGGGTG
GCCTTCCACGTGCCCAACGAACTGACCGGCGAAGGCAACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAG
CCCGGCGGCCGTGGCGCGCAAGGTCGATTCGTTGAACCAGTTGCTGGAAGCCCGCACCCAGCTGGCCAACCTGCTGACCT
ACATGGACGGCAAGACCGGCGCCGAAGAAATCATCATGAAAGCCATCAAGGATCCGGCGTTGCTCCAGGCCCTGGCCAGT
GCGCCAAAGCCTGCTGACTCCGAGCCGAACGCGTAA