Detailed information of component protein


Summary

Component ID T6CP008068
Component protein type TssJ
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (169 a.a.); Nucleotide sequence (507 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30135
Coordinate (Strand) 6704166..6704672 (-)
NCBI ID WP_011064252.1
RefSeq NC_021237
Uniprot ID A0A2C9EW26_PSEPH, Q4K3P1_PSEF5, A0A7U9LCH5_PSEFL
KEGG ID pprc:PFLCHA0_c60430, pfl:PFL_6084
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 1.2e-30 35..150

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-168 MIQRLLTLVAMLVLAACAKDTPPPGEPAKEAPGATTVELHFQAVSGLNPGPDGQSTPVRVRIFELKNPATFMRADYFALAERAPATLGPDLIDQDEVLVKPGDQFTLKRTLDPATRQVGLLVGYREVDQALWRVGVNTAQRLSNQYQIVLDVRAVSAELVASPSSPAQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9987 pos: 16-17. LAA-CA. MIQRLLTLVAMLVLAA



  Protein sequence: 169 a.a.    

>T6CP008068 NC_021237:c6704672-6704166 [Pseudomonas protegens CHA0] [TssJ]
MIQRLLTLVAMLVLAACAKDTPPPGEPAKEAPGATTVELHFQAVSGLNPGPDGQSTPVRVRIFELKNPATFMRADYFALA
ERAPATLGPDLIDQDEVLVKPGDQFTLKRTLDPATRQVGLLVGYREVDQALWRVGVNTAQRLSNQYQIVLDVRAVSAELV
ASPSSPAQ*

  Nucleotide sequence: 507 bp    

>T6CP008068 NC_021237:c6704672-6704166 [Pseudomonas protegens CHA0] [TssJ]
ATGATTCAACGATTGCTGACATTGGTTGCCATGCTGGTACTGGCGGCCTGTGCCAAGGACACACCACCTCCCGGCGAACC
GGCCAAGGAAGCGCCCGGCGCCACGACTGTGGAGCTGCATTTCCAGGCGGTCAGCGGGCTCAACCCCGGGCCTGATGGCC
AGAGCACGCCGGTGCGGGTACGGATCTTCGAGCTGAAGAATCCGGCCACCTTCATGCGCGCCGACTACTTCGCCCTGGCG
GAGCGGGCGCCGGCTACCCTCGGCCCGGACCTGATCGACCAGGATGAAGTGCTGGTCAAGCCCGGCGACCAGTTCACCCT
CAAGCGCACCCTGGACCCGGCCACCCGTCAGGTCGGCCTGCTGGTGGGCTATCGCGAAGTGGACCAGGCCCTGTGGCGGG
TCGGGGTCAACACCGCGCAGCGCCTGAGCAACCAATATCAGATCGTCCTCGACGTCCGCGCGGTCAGCGCCGAGCTCGTG
GCATCCCCATCCAGCCCTGCCCAATAG