Detailed information of component protein
Summary
| Component ID | T6CP008067 |
| Component protein type | TssK |
| T6SS ID (Type) | T6SS00764  (Type i3) |
| Strain | Pseudomonas protegens CHA0 |
| Replicon | chromosome |
| Sequence | Protein sequence (445 a.a.); Nucleotide sequence (1335 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 6702816..6704150 (-) |
| NCBI ID | WP_011064251.1 |
| RefSeq | NC_021237 |
| Uniprot ID | A0A2C9EVT4_PSEPH, A0A1K2AA06_9PSED, A0A2T0Z768_9PSED, Q4K3P2_PSEF5, A0A7U9Q4L9_PSEFL |
| KEGG ID | pfl:PFL_6083, pprc:PFLCHA0_c60420 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-444 | MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSTGAWGFSELRIDQGLLAQGKLAIVSARGLLPDGTPFNIPHDDLAPSPLCIDDNLRDGLVYLALPLKRAGARDTVDEGEELGGARYLSQVREVRDDNAPFENRAPVAVGSRALRLLTAQDGLSDYAAIGVVRVKEKRADRALVLDDSYIPPVLDVAASKPLSAFRSELLGLLHQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLVNHLSQISPLHPERLFSELVSLAGEFSTFTHSARRPEQYPQYQHDELAMSFAPVMQALREALSMLIDSKATPIPIVEKAYGVHVAMLADRTLLENASFILVVRADVPGETLRGRFAQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWKQLVHSGGFAFHVAGEFPGLNLAFWAIRG |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9941 | - | - |
Protein sequence: 445 a.a.
Nucleotide sequence: 1335 bp