Detailed information of component protein


Summary

Component ID T6CP008065
Component protein type TssM
T6SS ID (Type) T6SS00764 experimental (Type i3)
Strain Pseudomonas protegens CHA0
Replicon chromosome
Sequence Protein sequence (1169 a.a.); Nucleotide sequence (3507 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) PFLCHA0_RS30120
Coordinate (Strand) 6697981..6701487 (-)
NCBI ID WP_015637480.1
RefSeq NC_021237
Uniprot ID A0A2C9EWC9_PSEPH
KEGG ID pprc:PFLCHA0_c60400
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 3e-98 190..447
IcmF-related PF06761.14 5.9e-83 500..792
IcmF_C PF06744.14 1.4e-28 1043..1149

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 VKAFFS
Transmembrane helix 7-29 FVIRWVIPLLGLIALSLIIWFIG
Outside 30-38 PLLEFLVPE
Transmembrane helix 39-61 GRRWALIIFIFALWIGYRVFCII
Inside 62-439 QTRRHAAKVLQSLAADTPPDPDSVATAEELAALRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVNSGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSHATVDKAAWLGFLDLLKTQRSRRPIDGAFVAISLSDLLLGSEAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDSLSKEERAQVWGMTFALDDGKSGDSPLAHLPAELAALEQRLNERLVERLQQERDPARRDLIYGFPQQFAALKESLQSFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQTGTGRSYFIEKLFSAVAFAERGLVGVNPKVERRRK
Transmembrane helix 440-462 WIARGALAGTVALVLVVSTLWII
Outside 463-1168 SYRANQAYIAQVDQRVGPVRQDVQNLSPAQRDVLAVLPLLNATRHLAGDAPGWAEGLGLYQGDMLEAESASVYRKLLVAVFAPRLMTRIEEQLHSGGNSDFLYEGLKAYLMLADSEHYDPDFIKAWITLDWDHTLARDLPPDQRQALTGHLQALFEKHPPNARLDQRLIDDLRRQLQQLPVAQRVYDRVKRAKLPDGVPDFRLSEAGGRDAALVFTRKSGKPLSEPLSGLFTAKGYRQGFLLASLNQAGTLAEEQWVLGRDQADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADVLRILSGPTSPLKKLLVAVAKETDLQQEERLLAAQGQKVEGGVDQLKQRLGTLLGQEQSANPAAVASSEDPVSAHFAELNSLVSKGEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQASAAAARVSLTAERQPPVVQGLVKSVVGSTTNTMMGGVRNQLNAAWVSEVVNVYRQSLSGRYPMSPGSSRDATLEDFGQFFGTGGVMDNYFRKYLQPYVNTSTTTWSWQPGAAQKLGISPGVLQTFQRASNIRDAFFRSSGGTQPAVRFELKPVAMDADISQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRLSIMPPSATGRSGITLDGPWAWFRLLEQSDLTATNSPDRFNLRLRVDGASISYELRASSAFNPFKSRVLSGFSLPERL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9977 - -



  Protein sequence: 1169 a.a.    

>T6CP008065 NC_021237:c6701487-6697981 [Pseudomonas protegens CHA0] [TssM]
VKAFFSFVIRWVIPLLGLIALSLIIWFIGPLLEFLVPEGRRWALIIFIFALWIGYRVFCIIQTRRHAAKVLQSLAADTPP
DPDSVATAEELAALRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVNSGLHFPLAAQLGAGAVRGVG
GTRNCDWWFTDQAVLLDTAGRYTTQDSHATVDKAAWLGFLDLLKTQRSRRPIDGAFVAISLSDLLLGSEAERAAHAAAIR
LRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDSLSKEERAQVWGMTFALDDGKSGDSPLAHLPAELAALEQRLNERLV
ERLQQERDPARRDLIYGFPQQFAALKESLQSFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQH
LARQTGTGRSYFIEKLFSAVAFAERGLVGVNPKVERRRKWIARGALAGTVALVLVVSTLWIISYRANQAYIAQVDQRVGP
VRQDVQNLSPAQRDVLAVLPLLNATRHLAGDAPGWAEGLGLYQGDMLEAESASVYRKLLVAVFAPRLMTRIEEQLHSGGN
SDFLYEGLKAYLMLADSEHYDPDFIKAWITLDWDHTLARDLPPDQRQALTGHLQALFEKHPPNARLDQRLIDDLRRQLQQ
LPVAQRVYDRVKRAKLPDGVPDFRLSEAGGRDAALVFTRKSGKPLSEPLSGLFTAKGYRQGFLLASLNQAGTLAEEQWVL
GRDQADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADVLRILSGPTSPLKKLLVAVAKETDLQQEERL
LAAQGQKVEGGVDQLKQRLGTLLGQEQSANPAAVASSEDPVSAHFAELNSLVSKGEGEPAAIDGLLADMNALYVQVSAMV
GASGDALLGEAKNQASAAAARVSLTAERQPPVVQGLVKSVVGSTTNTMMGGVRNQLNAAWVSEVVNVYRQSLSGRYPMSP
GSSRDATLEDFGQFFGTGGVMDNYFRKYLQPYVNTSTTTWSWQPGAAQKLGISPGVLQTFQRASNIRDAFFRSSGGTQPA
VRFELKPVAMDADISQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRLSIMPPSATGRSGITLDGPWAWFRLLEQSD
LTATNSPDRFNLRLRVDGASISYELRASSAFNPFKSRVLSGFSLPERL*

  Nucleotide sequence: 3507 bp    

>T6CP008065 NC_021237:c6701487-6697981 [Pseudomonas protegens CHA0] [TssM]
GTGAAGGCGTTTTTCAGTTTTGTGATTCGCTGGGTGATCCCGCTGCTGGGGCTGATCGCCCTGAGCCTGATCATCTGGTT
CATTGGCCCGTTGCTGGAGTTCCTGGTACCGGAAGGCCGGCGTTGGGCGCTGATCATTTTCATCTTCGCGCTGTGGATCG
GCTACCGGGTGTTTTGCATCATCCAGACCCGTCGGCATGCGGCCAAGGTCTTGCAGAGCCTGGCCGCCGACACCCCGCCG
GACCCGGACAGCGTGGCCACTGCCGAGGAACTGGCCGCCCTGCGCCAGCGCATGGACGAAGCCCTGGCGCTGCTGAAGAA
GGCCAAGCTCGGCGGTGACGAGCGACGCAATCTCTACGAGCTGCCGTGGTACGTGATCATCGGTCCGCCGGGTTCCGGCA
AGACCACCGCACTGGTCAATTCCGGCCTGCATTTCCCCCTGGCCGCCCAGTTGGGCGCCGGTGCCGTACGCGGCGTGGGC
GGCACCCGCAACTGCGACTGGTGGTTCACCGACCAGGCCGTGCTGCTCGATACCGCCGGCCGCTACACCACTCAGGACAG
CCATGCCACGGTGGACAAGGCAGCCTGGCTGGGCTTTCTCGACCTGCTGAAAACCCAGCGCTCGCGGCGGCCGATCGATG
GCGCCTTCGTTGCCATCAGCCTCTCCGACCTGTTGCTCGGCAGCGAAGCGGAGCGCGCTGCCCACGCCGCAGCGATCCGC
CTGCGGATCCAGGAGCTGTACACCCAGCTGGGAGTGCGCTTCCCGATCTACCTGATGCTCACCAAGCTCGATCTGGTGCC
GGGTTTCATGGAGTTCTTCGACTCCCTGAGCAAGGAAGAGCGGGCCCAGGTCTGGGGCATGACCTTCGCCCTGGACGACG
GCAAGAGCGGTGACAGCCCCCTGGCCCACCTGCCGGCGGAACTGGCGGCCCTGGAGCAGCGGCTCAACGAGCGCCTGGTG
GAACGCCTGCAGCAGGAACGCGACCCGGCGCGGCGCGACCTGATCTACGGCTTCCCGCAGCAGTTCGCAGCGCTCAAGGA
ATCCTTGCAGAGCTTCCTGGAAGGGGTGTTCAAGCCCAATGCCTTCGAAGAGCGGGTACTGCTGCGCGGGGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCGCCATGGCCCAGAGCATGAACCTGGACCGCCAGCAC
CTGGCGCGGCAGACCGGCACCGGGCGCAGCTACTTCATCGAGAAGCTGTTCAGTGCCGTGGCCTTTGCCGAGCGCGGGCT
GGTGGGGGTCAACCCCAAGGTCGAGCGCCGGCGCAAATGGATCGCCCGTGGCGCCCTGGCTGGCACCGTAGCCCTGGTGC
TGGTGGTCAGCACCTTGTGGATCATCAGCTACAGGGCCAACCAGGCCTACATTGCCCAGGTCGACCAGCGCGTCGGCCCG
GTGCGCCAGGACGTGCAGAACCTCAGCCCGGCCCAGCGCGATGTGCTGGCGGTGCTGCCGCTGCTCAACGCCACCCGCCA
CCTGGCCGGCGACGCCCCGGGCTGGGCCGAAGGCCTGGGCCTGTACCAGGGCGACATGCTCGAAGCCGAGTCCGCCAGCG
TCTATCGCAAGCTGTTGGTGGCGGTGTTCGCCCCACGGCTGATGACCCGCATCGAAGAGCAACTGCACAGCGGCGGCAAC
TCGGACTTCCTCTACGAGGGGCTCAAGGCCTACCTGATGCTGGCGGACAGCGAGCACTACGACCCGGACTTCATCAAGGC
CTGGATCACCCTGGACTGGGATCACACCTTGGCCCGCGACCTGCCGCCGGACCAGCGTCAGGCCCTGACCGGGCACCTGC
AGGCGCTGTTCGAAAAACACCCACCGAACGCGCGCCTGGACCAGCGCCTGATCGACGACCTGCGCCGCCAGCTGCAACAG
CTGCCGGTGGCCCAGCGGGTGTATGACCGGGTCAAGCGCGCCAAGCTGCCGGACGGCGTGCCGGACTTTCGCCTCAGCGA
GGCCGGTGGCCGTGACGCCGCGCTGGTGTTCACCCGCAAGAGCGGCAAGCCGTTGAGCGAGCCCCTGAGCGGGCTGTTCA
CCGCCAAGGGCTACCGCCAGGGCTTCCTCCTGGCCAGCCTCAACCAGGCAGGCACCCTGGCGGAAGAACAGTGGGTGCTG
GGTCGCGATCAGGCCGACCAGCAGAACGTCGCCAGCCTTGCCGCCGACGTGCGCCGCCTGTACTTCCAGGATTACCTGCG
CCAGTGGGACGCCTTGCTGGCGGACATCGACTTCGTGCCGATCACCAGCGTGGCCCAGGCCGCCGACGTGCTGCGGATTC
TGTCCGGGCCCACTTCGCCGCTGAAGAAACTGTTGGTGGCCGTGGCCAAGGAAACCGACCTGCAACAGGAAGAACGCCTG
CTGGCGGCCCAGGGCCAGAAGGTCGAGGGCGGTGTGGACCAGCTCAAGCAACGCCTGGGTACCCTGCTGGGCCAGGAACA
GTCGGCCAACCCGGCTGCCGTGGCCAGCAGCGAAGACCCGGTGAGCGCGCACTTCGCCGAACTCAACAGCCTGGTGAGCA
AGGGCGAGGGCGAGCCGGCGGCCATCGACGGCCTGCTGGCGGACATGAACGCCCTGTACGTGCAGGTCAGCGCCATGGTC
GGGGCCAGCGGCGACGCGCTGCTGGGCGAGGCCAAGAACCAGGCCAGCGCCGCTGCGGCGCGGGTCAGCCTGACCGCCGA
GCGCCAGCCTCCGGTGGTCCAGGGGCTGGTCAAGTCGGTGGTGGGCTCCACCACCAACACCATGATGGGCGGGGTGCGCA
ACCAGCTGAACGCGGCCTGGGTCAGCGAAGTGGTGAACGTCTATCGCCAGTCCCTGAGCGGCCGTTACCCGATGTCGCCG
GGCAGCTCCCGGGACGCGACCCTGGAAGACTTCGGCCAGTTCTTCGGCACCGGCGGGGTGATGGACAACTACTTCCGCAA
GTACCTGCAGCCCTACGTCAACACCTCGACCACCACCTGGAGCTGGCAGCCAGGCGCGGCGCAGAAGCTGGGGATTTCCC
CTGGCGTGCTGCAGACCTTCCAGCGCGCTTCGAACATTCGCGACGCCTTCTTCCGCTCCAGTGGCGGTACCCAGCCGGCC
GTGCGTTTCGAACTCAAACCGGTGGCGATGGACGCCGATATCAGCCAGTTCCTCCTCGACCTGGACGGCCAGCAACTGAG
CTACGACCACGGCCCGAGCCGGCCGGTGGCCATGCAATGGCCCAACCCGGGGAGCATCGGCGTGGTGCGCCTGTCGATCA
TGCCGCCTTCGGCCACCGGGCGTTCCGGGATCACCCTGGATGGCCCCTGGGCCTGGTTCCGCCTGCTGGAGCAGTCGGAC
CTGACCGCCACCAATTCGCCGGACCGCTTCAACCTGCGGCTACGGGTGGACGGTGCGAGCATTTCCTACGAGCTGCGGGC
CAGCAGCGCCTTCAACCCGTTCAAGAGCCGGGTGCTCAGTGGCTTCAGCCTGCCGGAGCGGCTATGA