Detailed information of component protein


Summary

Component ID T6CP007576
Component protein type TssD
T6SS ID (Type) T6SS00720 experimental (Type i5)
Strain Vibrio parahaemolyticus BB22OP
Replicon chromosome II
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) VPBB_RS19920
Coordinate (Strand) 1050543..1051022 (-)
NCBI ID WP_005375967.1
RefSeq NC_019971
Uniprot ID A0A4P8G3D2_9VIBR, A0A2I3CRH4_VIBAX, S5J041_VIBPH, Q87HD8_VIBPA, A0A7Y3Q745_9VIBR, A0A0T7E196_9VIBR, C0LZR3_VIBAL, A0A072J8B2_VIBPH, D0X0J5_VIBAL
KEGG ID vnl:D3H41_17720, vpf:M634_23055, vpa:VPA1027, vag:N646_4398
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_HCP PF05638.14 1.2e-28 6..133

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPDLFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9833 - -



  Protein sequence: 160 a.a.    

>T6CP007576 NC_019971:c1051022-1050543 [Vibrio parahaemolyticus BB22OP] [TssD]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPDLFKEATIGKG
KPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM*

  Nucleotide sequence: 480 bp    

>T6CP007576 NC_019971:c1051022-1050543 [Vibrio parahaemolyticus BB22OP] [TssD]
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAAGGTGAAGCGACAGCGGAACAATATAAGGATTTAATTACACT
ACTATCTGTAGATTGGAGTGTTGGTCGTGAAATTTCTTCTTACACGGGTACAGCAATGGACCGTGAAGCAAGTGCAACAC
GCCTATATGATTTAACTATCACTAAACTTCAAGATCGTTCGTCTCCTGATCTATTCAAGGAAGCAACAATCGGTAAAGGT
AAACCTGCAGTATTCCACATCACTAAGCAGGGTGAAAAAGTTGAAGAAATCATGAAAATCGAACTGACTGATGCGATGAT
TTCTAACTACTCAGTATCGATTCAAGATGATCGCCCAGTAGAAACTATCACAATTTCATACACTGAAATGATGATGACAG
TGACACCTACTGATGACAAAAACAACACTTCTGCTCCGTTGGTTTACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA