Detailed information of component protein
Summary
| Component ID |
T6CP005177 |
| Component protein type |
IglC |
| T6SS ID (Type) |
T6SS00081  (Type ii) |
| Strain |
Francisella tularensis subsp. tularensis SCHU S4 |
| Replicon |
chromosome |
| Sequence |
Protein sequence (210 a.a.); Nucleotide sequence (630 bp) |
| Reference |
[1] Bröms JE, Meyer L, Sun K, et al. Unique substrates secreted by the type VI secretion system of Francisella tularensis during intramacrophage infection. PLoS One. 2012;7(11):e50473. doi: 10.1371/journal.pone.0050473. Epub 2012 Nov 20. PMID: 23185631[2] Nano FE, Schmerk C. The Francisella pathogenicity island. Ann N Y Acad Sci. 2007 Jun;1105:122-37. Epub 2007 Mar 29. PMID: 17395722[3] Long ME, Lindemann SR, Rasmussen JA, et al. Disruption of Francisella tularensis Schu S4 iglI, iglJ, and pdpC genes results in attenuation for growth in human macrophages and in vivo virulence in mice and reveals a unique phenotype for pdpC. Infect Immun. 2013 Mar;81(3):850-61. doi: 10.1128/IAI.00822-12. Epub 2012 Dec 28. PMID: 23275090[4] Long ME, Lindemann SR, Rasmussen JA, et al. Disruption of Francisella tularensis Schu S4 iglI, iglJ, and pdpC genes results in attenuation for growth in human macrophages and in vivo virulence in mice and reveals a unique phenotype for pdpC. Infect Immun. 2013 Mar;81(3):850-61. doi: 10.1128/IAI.00822-12. Epub 2012 Dec 28. PMID: 23275090 |
Experimental investigation has been performed on this T6SS
External database links
Pfam domain hit(s)
| Domain |
Pfam ID |
E-value |
Aligned region |
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction |
Region |
Sequence |
| Outside |
1-209 |
MSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAAASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIMIDLSNLELYPISAKAFSISIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction |
Probability |
Cleavage site |
Signal peptide sequence |
| Other |
0.9845 |
- |
- |
Protein sequence: 210 a.a.
Nucleotide sequence: 630 bp