Detailed information of component protein


Summary

Component ID T6CP005166
Component protein type IglE
T6SS ID (Type) T6SS00081 experimental (Type ii)
Strain Francisella tularensis subsp. tularensis SCHU S4
Replicon chromosome
Sequence Protein sequence (126 a.a.); Nucleotide sequence (378 bp)
Reference
[1] Bröms JE, Meyer L, Sun K, et al. Unique substrates secreted by the type VI secretion system of Francisella tularensis during intramacrophage infection. PLoS One. 2012;7(11):e50473. doi: 10.1371/journal.pone.0050473. Epub 2012 Nov 20. PMID: 23185631
[2] Nano FE, Schmerk C. The Francisella pathogenicity island. Ann N Y Acad Sci. 2007 Jun;1105:122-37. Epub 2007 Mar 29. PMID: 17395722
[3] Long ME, Lindemann SR, Rasmussen JA, et al. Disruption of Francisella tularensis Schu S4 iglI, iglJ, and pdpC genes results in attenuation for growth in human macrophages and in vivo virulence in mice and reveals a unique phenotype for pdpC. Infect Immun. 2013 Mar;81(3):850-61. doi: 10.1128/IAI.00822-12. Epub 2012 Dec 28. PMID: 23275090
[4] Long ME, Lindemann SR, Rasmussen JA, et al. Disruption of Francisella tularensis Schu S4 iglI, iglJ, and pdpC genes results in attenuation for growth in human macrophages and in vivo virulence in mice and reveals a unique phenotype for pdpC. Infect Immun. 2013 Mar;81(3):850-61. doi: 10.1128/IAI.00822-12. Epub 2012 Dec 28. PMID: 23275090
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) FTT_RS07060
Coordinate (Strand) 1385663..1386040 (+)
NCBI ID WP_003022128.1
RefSeq NC_006570
Uniprot ID A0A3N4A4Q7_FRATU, A0A6N3SCL0_FRATT, Q5NED6_FRATT
KEGG ID ftu:FTT_1346, ftu:FTT_1701
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-125 MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9962 pos: 21-22. LSS-CI. MYNKLLKNFCLVLSTIIGLSS



  Protein sequence: 126 a.a.    

>T6CP005166 NC_006570:1385663-1386040 [Francisella tularensis subsp. tularensis SCHU S4] [IglE]
MYNKLLKNFCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPL
DKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD*

  Nucleotide sequence: 378 bp    

>T6CP005166 NC_006570:1385663-1386040 [Francisella tularensis subsp. tularensis SCHU S4] [IglE]
ATGTACAATAAATTATTGAAAAATTTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATTAGTGATGGTTT
GTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAATATTTTCTACTCAGATAACT
ATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAATCTTAAAACAGGAAAGAATGAATTTCCATTA
GATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTCCTGAAAATAAAAAAACTGAAAACTGGAAATACATAATAAG
TTCAGATTCTGTAAATAAATTTACTATAAAAAATGATAGTAGCATAGAAAAAGATTAA