Detailed information of component protein


Summary

Component ID T6CP005149
Component protein type TssH
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (850 a.a.); Nucleotide sequence (2550 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24435
Coordinate (Strand) 4908894..4911443 (+)
NCBI ID WP_000029849.1
RefSeq NC_017626
Uniprot ID D3GV04_ECO44, A0A3J8YFL8_ECOLX, B7LFQ0_ECO55, A0A8B3KLK1_SHISO
KEGG ID elo:EC042_4577, eck:EC55989_3283
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 2.4e-40 577..740
AAA_lid_9 PF17871.3 1.4e-24 353..444
ClpB_D2-small PF10431.11 9.2e-10 747..821
AAA PF00004.31 9.8e-09 213..325

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-849 VSIYLKPIINKLTPESRNTLDSAINYAISRSHHEVDCLHLLWKLLQEHKYIAEVLYEQSLFNPEWVLNAIESELIRINTVPQSSPVFSESMQTLLEKTWIHASTKWQIDHIDIPVFLSTMINFRDSIFPLNVSDALCCDMDVAEELLISFSDEAEHSASHRPTDRSSHEYLSKYTENLSLRAETGKLDPVTGREKEVRQLIDILLRRRQNNPILTGEPGVGKSSIVEGLALQIASGRVPDVLKNVRIHALDMGALLAGASVRGEFENRLKSLLTELNSLDGTAILFIDEAHSLIGAGGLPGQTDAANLLKPALARGELRIIAATTWGEYKKYFEKDGALARRFQIVKVAEPNQDVTAEMLRSLLPMMEKHHNVSIREEAITATVHLSDRYLHGRRQPDKSVSLLDTACSRVAVSQSTSPDAIQDVEASLVRYQGELALLTQERSDVLRQEMLANKIAQLEEELEQLKSAWRHQSELVAKIQSSDDISSKNMYRKELESAYKKDSPMVFECVDKNCVADVVSGWTGVPLGVCLDGEQQKASGLLRCLEQRVLGQRYAMSAIASQVLICRADLKDPVKPDGVFLLAGPSGTGKTETARALAEFVYGDENKLITINMTEFQEAHTVSTLKGAPPGYVGFGQGGTLTERVSHNPYSVILLDEIEKAHPDVLEFFFQIFDSGIIEDAEGKMVSFRDCLIIMTSNFASENITNIWNDGETNRDRIKEMLLPLFNEHFGAAFMGRTNLIPFTPLHSKTLRDIVLIKIDKICQRFEQASGQMYKIEYNDSLIDWITHHCQCDKSGARDIDSVLNSTVLPVLARYLTDSEDNRTPKKIRISVRKNNITLRSSQFATRN



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9974 - -



  Protein sequence: 850 a.a.    

>T6CP005149 NC_017626:4908894-4911443 [Escherichia coli 042] [TssH]
VSIYLKPIINKLTPESRNTLDSAINYAISRSHHEVDCLHLLWKLLQEHKYIAEVLYEQSLFNPEWVLNAIESELIRINTV
PQSSPVFSESMQTLLEKTWIHASTKWQIDHIDIPVFLSTMINFRDSIFPLNVSDALCCDMDVAEELLISFSDEAEHSASH
RPTDRSSHEYLSKYTENLSLRAETGKLDPVTGREKEVRQLIDILLRRRQNNPILTGEPGVGKSSIVEGLALQIASGRVPD
VLKNVRIHALDMGALLAGASVRGEFENRLKSLLTELNSLDGTAILFIDEAHSLIGAGGLPGQTDAANLLKPALARGELRI
IAATTWGEYKKYFEKDGALARRFQIVKVAEPNQDVTAEMLRSLLPMMEKHHNVSIREEAITATVHLSDRYLHGRRQPDKS
VSLLDTACSRVAVSQSTSPDAIQDVEASLVRYQGELALLTQERSDVLRQEMLANKIAQLEEELEQLKSAWRHQSELVAKI
QSSDDISSKNMYRKELESAYKKDSPMVFECVDKNCVADVVSGWTGVPLGVCLDGEQQKASGLLRCLEQRVLGQRYAMSAI
ASQVLICRADLKDPVKPDGVFLLAGPSGTGKTETARALAEFVYGDENKLITINMTEFQEAHTVSTLKGAPPGYVGFGQGG
TLTERVSHNPYSVILLDEIEKAHPDVLEFFFQIFDSGIIEDAEGKMVSFRDCLIIMTSNFASENITNIWNDGETNRDRIK
EMLLPLFNEHFGAAFMGRTNLIPFTPLHSKTLRDIVLIKIDKICQRFEQASGQMYKIEYNDSLIDWITHHCQCDKSGARD
IDSVLNSTVLPVLARYLTDSEDNRTPKKIRISVRKNNITLRSSQFATRN*

  Nucleotide sequence: 2550 bp    

>T6CP005149 NC_017626:4908894-4911443 [Escherichia coli 042] [TssH]
GTGAGTATCTATCTGAAACCAATTATTAATAAATTAACTCCAGAAAGTCGAAATACTCTGGATTCTGCAATTAATTACGC
AATATCAAGGTCACATCATGAAGTAGACTGTCTACATCTTCTATGGAAGTTATTGCAGGAACATAAATATATAGCCGAAG
TGCTTTATGAGCAGTCCTTATTTAATCCTGAGTGGGTTCTTAATGCTATTGAAAGTGAACTTATCCGTATCAATACAGTA
CCACAATCCTCACCTGTATTTTCTGAGTCGATGCAGACTCTACTGGAGAAAACATGGATACATGCCAGTACTAAATGGCA
AATCGATCATATAGATATCCCTGTCTTTTTGAGTACTATGATTAATTTCAGAGATTCAATATTTCCTCTCAATGTTTCTG
ATGCGTTATGTTGTGATATGGATGTAGCTGAGGAGTTACTTATCTCTTTTTCAGACGAAGCAGAGCATTCTGCTTCTCAT
CGTCCCACCGATAGGTCTTCACATGAATATCTCAGTAAATATACTGAGAATCTCTCTCTGCGGGCAGAAACAGGTAAATT
AGATCCGGTTACTGGCAGAGAGAAGGAAGTCAGACAACTTATCGATATTTTGCTTCGTCGCAGACAGAATAATCCAATAC
TGACCGGTGAACCGGGAGTAGGGAAAAGTAGTATAGTAGAAGGTTTAGCACTGCAAATTGCGTCTGGCCGTGTGCCTGAT
GTACTGAAGAATGTCCGGATCCATGCCCTTGATATGGGGGCTCTGCTTGCGGGAGCCAGTGTCAGAGGGGAATTCGAAAA
TCGCCTAAAATCACTGTTGACCGAACTTAATTCTTTGGATGGCACAGCTATTTTGTTTATTGATGAGGCTCATTCCCTTA
TCGGTGCAGGAGGACTTCCGGGACAGACTGATGCAGCTAATTTGCTTAAGCCTGCTCTTGCCCGTGGAGAATTGCGCATT
ATAGCCGCAACGACATGGGGAGAATATAAAAAGTATTTTGAAAAGGATGGGGCGTTAGCCCGGCGTTTTCAGATAGTAAA
AGTAGCAGAGCCAAATCAGGATGTCACAGCGGAAATGCTACGTTCTCTTTTGCCCATGATGGAAAAACACCATAATGTTT
CTATCAGGGAAGAAGCAATAACTGCAACGGTACATCTATCAGACCGTTATCTGCATGGGCGCCGTCAACCAGATAAATCT
GTAAGTCTGTTAGATACAGCTTGTTCTCGGGTTGCTGTATCTCAGTCTACATCACCAGATGCCATTCAGGATGTCGAAGC
TTCATTGGTAAGATACCAAGGGGAACTTGCGCTGCTGACACAGGAAAGGTCAGATGTTTTGCGTCAGGAAATGCTTGCAA
ATAAAATTGCTCAACTTGAGGAGGAGCTTGAGCAACTCAAATCAGCGTGGCGTCATCAAAGTGAACTGGTTGCAAAAATA
CAAAGTTCAGATGATATTTCATCAAAGAATATGTACAGAAAAGAACTGGAAAGTGCATATAAGAAAGACAGTCCTATGGT
TTTTGAGTGTGTGGATAAAAATTGTGTTGCTGATGTTGTTTCTGGGTGGACAGGTGTTCCACTGGGTGTATGCCTTGATG
GTGAACAACAAAAAGCATCCGGTCTGTTAAGATGCTTGGAGCAGCGAGTTTTGGGGCAGCGATATGCTATGTCCGCTATT
GCATCACAAGTTCTTATTTGTCGGGCAGATCTTAAAGATCCTGTAAAACCTGATGGGGTATTTTTACTTGCGGGCCCTTC
TGGCACAGGCAAAACGGAGACAGCCAGGGCGCTGGCCGAGTTTGTTTATGGGGATGAGAATAAACTCATCACGATTAATA
TGACTGAATTTCAGGAAGCTCACACTGTTTCCACTCTGAAGGGGGCACCTCCTGGATATGTTGGTTTTGGTCAGGGAGGG
ACTCTTACTGAAAGGGTGAGTCATAATCCATACAGTGTTATTCTGCTTGATGAAATTGAAAAAGCACATCCGGATGTCCT
GGAGTTCTTCTTCCAGATATTTGACTCAGGTATTATCGAGGATGCTGAAGGTAAGATGGTGTCTTTCAGAGATTGTCTCA
TAATAATGACATCAAACTTTGCCAGTGAAAATATCACAAACATATGGAATGATGGTGAGACAAATAGAGACAGAATAAAA
GAAATGCTTCTTCCTTTGTTTAATGAGCATTTTGGGGCGGCATTTATGGGGAGAACTAACTTAATTCCGTTCACACCGTT
GCATTCCAAAACACTGAGAGATATCGTACTCATTAAAATTGATAAGATCTGCCAACGTTTTGAACAGGCATCAGGTCAGA
TGTATAAGATAGAATACAATGATTCTCTTATTGACTGGATTACACATCATTGTCAATGTGATAAGTCTGGAGCTAGGGAT
ATAGACTCAGTACTTAACAGCACGGTTCTTCCTGTCTTGGCCAGATATTTGACTGACTCTGAAGATAATAGAACCCCCAA
GAAAATAAGAATATCAGTAAGGAAAAATAACATTACATTACGTAGTTCGCAATTTGCAACTCGTAATTGA