Detailed information of component protein


Summary

Component ID T6CP005147
Component protein type TssK
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (471 a.a.); Nucleotide sequence (1413 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24415
Coordinate (Strand) 4903139..4904551 (+)
NCBI ID WP_001154665.1
RefSeq NC_017626
Uniprot ID A0A0E0XVZ0_ECO1C, D3GV00_ECO44, A0A2H3MFZ0_ECOLX, A0A8B3KEP3_SHISO
KEGG ID esl:O3K_04415, elo:EC042_4574
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.5e-66 20..446

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-470 MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVLSSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNVYHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAEIYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEISTFHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEYGAGSNSDYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKIDKHSELWTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9948 - -



  Protein sequence: 471 a.a.    

>T6CP005147 NC_017626:4903139-4904551 [Escherichia coli 042] [TssK]
MQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVEKIKAVLSSGYYIEYPG
NCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDERNMRNVYHDSQDADITRIKYDIQILT
DEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKLRNKIAEIYSDIKFYKNRLEKYRYTERTVSDGHLYNF
LILCAINRTLPLLSSFINEDAIHPWLYYMALCQFAGEISTFHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSC
RDKIISVEFRKITTDTLICNFDEYGAGSNSDYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVT
SDLQVRENTIWLKIDKHSELWTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR*

  Nucleotide sequence: 1413 bp    

>T6CP005147 NC_017626:4903139-4904551 [Escherichia coli 042] [TssK]
ATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAACCTCAGCACTTTCAGTCAATTGACTTGCA
TCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACCCCATCATCAGGGGTACTATGAATGTTGTATCAATGATG
ATCTTCTTAAGGAAGATACTGTCAGAGTTGAAAAAATAAAGGCTGTTTTATCTTCAGGGTATTATATCGAGTATCCGGGT
AACTGTGTGGTACAGGATAAGTGCCTGACAAATCTCAAAGGTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAA
GAGATTCAATTCCGGTCATAAAAATGTCTCCAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATG
AACGTAACATGCGTAATGTTTATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGATTCTTACA
GATGAGGAAAAAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGGAAATAATTCATTGTGTAT
TGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTTAGAAATAAGATCGCAGAGATCTATTCGG
ATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATACAGAACGAACAGTGTCCGATGGACATCTTTATAACTTT
TTAATTCTATGTGCTATTAATAGGACATTACCACTTCTTTCTTCATTCATTAATGAAGATGCCATTCACCCATGGTTGTA
TTATATGGCATTATGTCAGTTTGCAGGGGAAATATCTACATTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAAC
TATCATACAATCATTATGAGCAGATCTCATGTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGT
CGAGATAAGATTATTAGTGTTGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTACGGTGCCGG
AAGTAATTCAGATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTGCATTGCCAGAGATTAAGA
TTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAATCAAGTTTACAGTGATGGATGCCGTTACA
TCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATAGATAAACATTCAGAATTATGGACGTTAGCTCAGACTCA
AAAAAGAGTTGCATTCTATTGGTCATGTAGTCCTGATGATTTACTTGTAGAGTTAGTATTATCGCAGGAAAAGTATGCCG
TAAGCAGGCCTAAACAGGATAACGGTTCTTTCCATCCGGCGGTTGGCAGATAA