Detailed information of component protein


Summary

Component ID T6CP005145
Component protein type TssI
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (661 a.a.); Nucleotide sequence (1983 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24390
Coordinate (Strand) 4898712..4900694 (+)
NCBI ID WP_000198270.1
RefSeq NC_017626
Uniprot ID A0A0E0XVY5_ECO1C, A0A222QR63_ECOLX, A0A2H3M840_ECOLX, B7LFQ9_ECO55, D3GUZ5_ECO44, H4UNT0_ECOLX
KEGG ID esl:O3K_04390, eck:EC55989_3292, elo:EC042_4569
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
Phage_GPD PF05954.13 5.5e-38 37..319
Phage_base_V PF04717.14 8.8e-14 382..451
DUF2345 PF10106.11 3.3e-05 494..631

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-660 MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLDKLHGTRLSCEIGEQYNSLPARFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTRVWSNIKPSDIVSTILEDSLFSPPQVILYKEQNLLEYKIQYQESDLDFINRILSEAGIYYFFVHNRDKHIMTLADDPASHPKASYDKLEHLPCENLKESRHGYIREWSFTESLKCPSVTLSGYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELIKKRSEALIASCDSELKIWSGKTDSWWLSCGECFSLDKQDYRITSLYLNAVNNDNEHAGLCYCDLCASDNKSSLNFSREFKTPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAAGTDKTSCWVRVSQVWSGEGFGSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKKGEGHQLVFDDKEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRLVLKEGDLHNDVHGNINIKVSNGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITISTSGIDIKAAKITIEGQVSAEVKAATLKFESQAISEVKGTMLTLQGSAMTQIKGGIVNIG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9809 - -



  Protein sequence: 661 a.a.    

>T6CP005145 NC_017626:4898712-4900694 [Escherichia coli 042] [TssI]
MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLDKLHGTRLSCEIGEQYNSLPA
RFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTRVWSNIKPSDIVSTILEDSLFSPPQVILYKEQNLLEYKIQY
QESDLDFINRILSEAGIYYFFVHNRDKHIMTLADDPASHPKASYDKLEHLPCENLKESRHGYIREWSFTESLKCPSVTLS
GYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELIKKRSEALIASCDSELKIWSGKTDSWWLSCGECFSLDKQDY
RITSLYLNAVNNDNEHAGLCYCDLCASDNKSSLNFSREFKTPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAA
GTDKTSCWVRVSQVWSGEGFGSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKK
GEGHQLVFDDKEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRLVLKEGDLHNDVHGNINIKVS
NGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITISTSGIDIKAAKITIEGQVSAEVKAATLKFESQAISEVKGT
MLTLQGSAMTQIKGGIVNIG*

  Nucleotide sequence: 1983 bp    

>T6CP005145 NC_017626:4898712-4900694 [Escherichia coli 042] [TssI]
ATGACTAGGCAAAGATTTATATCTGACGATCATTATAAATTCCAGAGTGAACATTTTATCCGGTTGCACGGCTGTGATAT
ATCATTATTTCCACTTGAGATTAAAGGTAAAGAGTCAATATCTGATGTATATAGTTATGAAATAAAATGCTTTAGTAGGA
CCGACCACAACTCTCTGGATAAGTTACACGGCACGCGTTTGAGTTGTGAGATCGGGGAACAATACAATTCGTTACCTGCG
CGCTTCATTCATGGTGTGGTCACAAAAGTGATATATAATTATGATAACAGCATGCAACATACCTGCATTATTATCTTACA
ACCAGAGATAGCCGAATTGGCATCTGGTAAAAGAACAAGAGTATGGTCAAATATAAAGCCATCAGATATTGTAAGCACAA
TTCTGGAAGACAGTTTATTTAGTCCGCCACAAGTAATTTTATATAAAGAACAGAATTTGCTGGAGTATAAGATCCAGTAC
CAGGAGTCAGATCTTGACTTTATTAATAGAATTTTGTCTGAGGCGGGCATTTACTATTTCTTTGTTCATAATAGAGATAA
ACATATTATGACATTGGCAGATGATCCTGCATCTCATCCTAAAGCATCTTATGATAAACTGGAACACTTACCCTGTGAAA
ATCTGAAGGAATCGCGTCATGGCTATATCAGGGAATGGTCTTTCACAGAAAGTCTCAAATGTCCTTCTGTGACACTTTCA
GGTTATAATGAGAGTAATGTCAGTGAAATTACTATAAAGTCAGAAAGTAAACTGACGGATGTAAAACCCAGTAAGGGAGT
TTATGAAGATATTATCCCAGAGAGAAAGCGTGAGTTGATAAAGAAACGTTCTGAAGCACTGATAGCATCATGTGACAGTG
AACTCAAAATCTGGTCAGGAAAAACGGATTCATGGTGGTTGTCATGCGGGGAGTGTTTCAGTCTGGACAAACAGGATTAC
AGAATTACTTCGTTATATCTTAATGCTGTCAACAATGACAATGAACATGCTGGTTTGTGTTATTGTGATTTGTGTGCTTC
AGATAATAAAAGCTCACTTAATTTCAGCCGTGAATTTAAAACACCTATTATTCCCGGTGTTTTACTTGCCAGAGTGGTCG
GTCCTGACTCCGAAGAATATTATACAGATGATAATGGGCGTGTAAAAATCAGCTTTCTCTGGGGAGAAAAGTCAGCGGCA
GGTACAGATAAAACCTCCTGTTGGGTCCGTGTATCTCAGGTATGGTCCGGGGAGGGATTCGGTAGTCAGTTTATTCCTCG
CATTGGCAGTGAGGTTCTGGTTAGTTTTATACAGGGTAATCCTGACTATCCAGTTATCGTTGGTACAGTGTATAATGGTC
AGAATACATCGCCTTTTTCTCTTCCTGAGAATAATTGTAAGTCTGGATTTATCACCCGTAGTGTTAAGAATGGTAAAAAA
GGAGAAGGTCATCAACTGGTTTTTGATGATAAAGAAGGTGAGGAAAAAGTTATAGTGACTTCATCTGGTGATTCTCTCCT
GACTGTAAAGAAGGATATGATCAGCACTATTAACCGCTCTATGTCGTTAACTATTGCTGAAGGGCGTAATGCTGAAATAA
AAAGAGGGAATGACAGGCTTGTTCTTAAAGAAGGTGACCTACATAATGATGTACATGGTAATATTAATATAAAAGTTTCG
AACGGAGATTATAATCTTAAAGTGAGCGGGGGAAGTGGTAGTCTTATCACCGATAAGAATCTTACTCTTGAATCAACACA
GTCAATAAAAATAAAAGTGGGTGCAAATGAGATAACGATATCCACATCAGGTATAGATATAAAAGCCGCTAAAATTACTA
TAGAAGGGCAGGTATCGGCAGAGGTCAAAGCGGCCACACTTAAGTTTGAAAGCCAGGCTATTTCTGAGGTAAAAGGCACC
ATGTTGACGCTTCAGGGCTCTGCAATGACACAGATAAAAGGTGGAATCGTGAATATAGGATAA