Detailed information of component protein


Summary

Component ID T6CP005144
Component protein type TssG
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (311 a.a.); Nucleotide sequence (933 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24385
Coordinate (Strand) 4897767..4898699 (+)
NCBI ID WP_001173973.1
RefSeq NC_017626
Uniprot ID D3GUZ4_ECO44, A0A3J9C131_ECOLX, A0A8B3KLJ4_SHISO
KEGG ID elo:EC042_4568
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssG PF06996.13 1.7e-53 8..294

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-310 MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLFDNGLTGATGILPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNVLLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLYTLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNNDNQLNINNKLGFNLSLGSETENYKERCFCIF



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9952 - -



  Protein sequence: 311 a.a.    

>T6CP005144 NC_017626:4897767-4898699 [Escherichia coli 042] [TssG]
MALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEKDGKYHLTLFDNGLTGATGI
LPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENRRDNNVLNNVLLSLGGITPQTVSVTGLAYV
AFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSEQGVLGNCLYTLGEGPVIGNVRWVVDSHFDVVLGPVDYRK
AQELMPGKDSHYFIRQQIRSYIGDVLKFKIYVKIYPGNNDNQLNINNKLGFNLSLGSETENYKERCFCIF*

  Nucleotide sequence: 933 bp    

>T6CP005144 NC_017626:4897767-4898699 [Escherichia coli 042] [TssG]
ATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATAAAGTCCGTGTGTTATTGAAAAATATTCTGAAACCAGA
TGAAAGCGTTGAAGACGTTGTTGATGAACATTTCAGATTTACATCAAGTCTGTCTTTAGATGCACCTGACGGTCAGATAG
AGAACCTGTATCAGGATGAGAAGGACGGAAAGTATCATCTCACATTATTCGATAATGGATTAACCGGGGCTACAGGGATT
CTTCCTGCCGCATATACAGAATGGCTGATTGAAAGGAAATTACGTTATAATGATGACGCTCCTAAGGCATTCATGGACAT
GTTTGACCATAGAATGTATTGTCTTTCTTATCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGAAGGGATA
ATAATGTTCTTAACAATGTTCTTTTATCTTTAGGCGGGATCACTCCTCAGACAGTTAGTGTGACAGGTCTGGCATACGTT
GCATTCTATTCACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTCGTTAATACATCAAATCAGAGTGTCCAT
TAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAGCAGGGGGTTCTGGGGAATTGCCTCTATACTCTGGGGG
AAGGTCCTGTCATAGGCAATGTTCGTTGGGTGGTTGATTCACATTTTGATGTTGTATTGGGGCCTGTGGACTATAGAAAA
GCACAGGAACTTATGCCGGGAAAAGATTCCCACTATTTTATCAGACAACAAATAAGATCGTATATAGGTGATGTTCTTAA
GTTCAAAATATATGTGAAAATCTATCCCGGTAACAATGATAATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTT
CACTCGGTTCTGAAACAGAAAATTATAAAGAACGGTGCTTTTGTATATTTTGA