Detailed information of component protein


Summary

Component ID T6CP005143
Component protein type TssF
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (601 a.a.); Nucleotide sequence (1803 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24380
Coordinate (Strand) 4895974..4897776 (+)
NCBI ID WP_001390300.1
RefSeq NC_017626
Uniprot ID A0A222QQF7_ECOLX, A0A2H3M0V1_ECOLX, B7LFR1_ECO55, D3GUZ3_ECO44, H4UNT2_ECOLX
KEGG ID elo:EC042_4566, eck:EC55989_3294
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 2.1e-141 2..596

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-600 MNKLLSYYQKELAFLRKQGIEFAKKYPKVARRLGYNQGGSEDPHVQRLTESFAFLSSKIHQRLDEDLPELMEALLRNLAPQFLYNYPSSCIVSFEPDRKSSGITSTYRVPSGTSLYSRYKYKTICQFRTVYPLTIVPATVNKARIHYDNSSSLWKIELNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGAGFYESEVTLPQKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEKYEPDRIERNVSERLFKVNCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYENDIVKQFPLKNLFGLEHSVIKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGDFDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMKLREMLSIYNYNNNHSISIFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFLDHFLGLHAPVNSFTRMITVIEHEEHTRRVWPIRAGKLTWL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9898 - -



  Protein sequence: 601 a.a.    

>T6CP005143 NC_017626:4895974-4897776 [Escherichia coli 042] [TssF]
MNKLLSYYQKELAFLRKQGIEFAKKYPKVARRLGYNQGGSEDPHVQRLTESFAFLSSKIHQRLDEDLPELMEALLRNLAP
QFLYNYPSSCIVSFEPDRKSSGITSTYRVPSGTSLYSRYKYKTICQFRTVYPLTIVPATVNKARIHYDNSSSLWKIELNL
DVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDISANISGAGFYESEVTLPQKGNVSYIHNLIL
DYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEKYEPDRIERNVSERLFKVNCSPVVNLFEKKTEPLRLSDGQD
EYQVNTDLYSRNEVLIWDINKVTLHRYENDIVKQFPLKNLFGLEHSVIKQSCNIFWHSSCYRSSSERGNFEESVYIRLSD
DGGAQSCIMTGDVLSIDAICTNGNIPSSINNGDPDGDFDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFV
LLSGTDGAMKLREMLSIYNYNNNHSISIFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFL
DHFLGLHAPVNSFTRMITVIEHEEHTRRVWPIRAGKLTWL*

  Nucleotide sequence: 1803 bp    

>T6CP005143 NC_017626:4895974-4897776 [Escherichia coli 042] [TssF]
ATGAATAAACTATTATCTTACTATCAGAAAGAACTCGCTTTTCTTAGAAAACAAGGTATTGAGTTTGCAAAAAAATATCC
AAAGGTAGCCCGGCGTCTTGGATACAATCAGGGGGGGTCTGAAGATCCACATGTTCAGAGATTAACGGAGTCTTTTGCTT
TCTTAAGTTCAAAAATTCATCAGAGATTAGATGAAGATTTACCCGAGTTAATGGAAGCATTACTTCGTAATCTTGCTCCC
CAATTTTTGTATAACTATCCTTCATCATGTATTGTATCATTTGAACCAGACAGAAAATCCAGTGGAATAACTTCAACTTA
TAGAGTTCCTTCTGGCACATCGCTATATTCCAGATATAAATATAAAACCATCTGTCAGTTTCGGACGGTATATCCACTGA
CTATTGTCCCTGCAACGGTTAATAAAGCAAGAATTCACTATGATAATTCGTCCTCCTTATGGAAAATTGAATTGAATTTA
GACGTTTTCGACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGGCAACGGTTACTGGTATAAT
ATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAATGATGTGTTATATGATATCAGTGCTAATA
TATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCACAAAAAGGGAACGTTTCTTATATACATAACCTCATACTG
GACTATTTTTCTTTTCCAGAACGATTTAACTTCATTGATATAGAATTTGACTCCGGAATCGAATTATGCTCAGGGGATTC
TGTGAGAATAGAAATAACATTAAAAAGCAGTGCAGAAAAGTATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGAC
TTTTTAAAGTAAACTGTTCTCCCGTTGTCAATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGAT
GAGTATCAGGTAAATACCGATTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATTGCACAGATA
TGAAAATGATATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTCATTAAACAATCGTGCAATA
TATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTGAGGAAAGTGTATATATTCGTCTGAGCGAT
GATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCTTTCAATTGATGCAATATGTACAAATGGTAATATTCCATC
ATCAATTAATAATGGTGATCCTGATGGTGATTTTGATTGTGATATAGATATTGCTCAGCTGCGAATAACTGCGCTGAACC
GTCCATCAAGAATGTTGCCGGCTATGGCATTAAAAGGAATGAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTG
TTGCTCAGTGGTACTGATGGGGCAATGAAACTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATC
AATTTTTATTGAATGGATTAAAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGCCTGTAACTG
CTCGTGGAATTGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTTCATGTTTTGCTCTTTCCTT
GATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATTACTGTCATTGAACATGAGGAGCACACTCG
TCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTTGA