Detailed information of component protein


Summary

Component ID T6CP005142
Component protein type TssC
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (493 a.a.); Nucleotide sequence (1479 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24365
Coordinate (Strand) 4893555..4895033 (+)
NCBI ID WP_000215053.1
RefSeq NC_017626
Uniprot ID A0A0E0XUC1_ECO1C, A0A222QQR4_ECOLX, A0A2H3MFY1_ECOLX, B7LFQ8_ECO55, D3GUZ0_ECO44, H4UNT5_ECOLX
KEGG ID elo:EC042_4563, eck:EC55989_3297, esl:O3K_04360
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 2.1e-123 67..367
VipB_2 PF18945.2 1.4e-46 376..487

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-492 MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIADIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFKNIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRDLAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAFELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLVYCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTYLQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSSVS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9706 - -



  Protein sequence: 493 a.a.    

>T6CP005142 NC_017626:4893555-4895033 [Escherichia coli 042] [TssC]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIADIDKLMSEQL
SLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFKNIYESEYGTFGGTPYSAFVG
DFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRDLAKLFETTDYARWRSFRQTDDSRYVGLTLP
QSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAFELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHT
GERLLQCPTEVAISDRREKELSDLGFIPLVYCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYL
KVIVRDKVGSFMSRTECQTYLQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMS
LRLVADLPSSVS*

  Nucleotide sequence: 1479 bp    

>T6CP005142 NC_017626:4893555-4895033 [Escherichia coli 042] [TssC]
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTATAAATAATAC
CAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCTTGCTGAAGTTGCCAGTGGTT
CTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCTGATATTGATAAGTTGATGTCTGAGCAGCTT
AGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAATCAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGT
TACTGAAAATGTAAAATACACGGTGTTACACTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCG
ATCAGTCTGTCTTATTTAAGAATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGT
GATTTCTATTTTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGATCTGGCAAAAT
TGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTTATGTGGGATTGACTTTGCCA
CAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAACGTTTAATTTTGAAGAGCACATTAGTGAAGA
TAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTTGAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATG
GCTGGTGTGCAGCAATTCGGGGCGTGGAAGGTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACA
GGTGAGCGACTTTTACAATGTCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTAT
TCCTCTGGTTTATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGCACATTATCTT
AAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATATCTGCAAAACTGGATCATGCA
ATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATCCATTACGTGAGGCATCTGTTGAAGTTATTG
AAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATGGATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCA
TTGCGTCTTGTTGCTGATTTACCATCAAGTGTAAGTTAA