Detailed information of component protein


Summary

Component ID T6CP005141
Component protein type TssB
T6SS ID (Type) T6SS00464 experimental (Type i4b)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) EC042_RS24360
Coordinate (Strand) 4893076..4893552 (+)
NCBI ID WP_000072549.1
RefSeq NC_017626
Uniprot ID A0A0E0XW46_ECO1C, A0A222QPX0_ECOLX, A0A2H3MMK8_ECOLX, B7LFR5_ECO55, D3GUY9_ECO44, H4UNT6_ECOLX
KEGG ID esl:O3K_04355, elo:EC042_4562, eck:EC55989_3298
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 3.8e-46 9..147

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-158 MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASMSPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKLQELLVTTNGNPENDESKE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9956 - -



  Protein sequence: 159 a.a.    

>T6CP005141 NC_017626:4893076-4893552 [Escherichia coli 042] [TssB]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASMSPTAHFMVDS
VIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKLQELLVTTNGNPENDESKE*

  Nucleotide sequence: 477 bp    

>T6CP005141 NC_017626:4893076-4893552 [Escherichia coli 042] [TssB]
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAACCGGAGATGC
TGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGAAAAACCATTGAGAGAACGAA
AATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATGAGTCCGACTGCTCATTTTATGGTGGACAGT
GTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGAGGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGAT
TCAACAGGTTGAGTGTCTAAGAAAATTATCGGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATG
AGAAACTGAAAGAAAAACTTCAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA