Detailed information of component protein


Summary

Component ID T6CP005140
Component protein type TssE
T6SS ID (Type) T6SS00463 experimental (Type i2)
Strain Escherichia coli 042
Replicon chromosome
Sequence Protein sequence (144 a.a.); Nucleotide sequence (432 bp)
Reference
[1] Durand E, Zoued A, Spinelli S, et al. Structural characterization and oligomerization of the TssL protein, a component shared by bacterial type VI and type IVb secretion systems. J Biol Chem. 2012 Apr 20;287(17):14157-68. doi: 10.1074/jbc.M111.338731. Epub 2012 Feb 27. PMID: 22371492
[2] Felisberto-Rodrigues C, Durand E, Aschtgen MS, et al. Towards a structural comprehension of bacterial type VI secretion systems: characterization of the TssJ-TssM complex of an Escherichia coli pathovar. PLoS Pathog. 2011 Nov;7(11):e1002386. doi: 10.1371/journal.ppat.1002386. Epub 2011 Nov 10. PMID: 22102820
[3] Dudley EG, Thomson NR, Parkhill J, et al. Proteomic and microarray characterization of the AggR regulon identifies a pheU pathogenicity island in enteroaggregative Escherichia coli. Mol Microbiol. 2006 Sep;61(5):1267-82. PMID: 16925558
[4] Morin N, Santiago AE, Ernst RK, et al. Characterization of the AggR regulon in enteroaggregative Escherichia coli. Infect Immun. 2013 Jan;81(1):122-32. doi: 10.1128/IAI.00676-12. Epub 2012 Oct 22. PMID: 23090962
[5] Zoued A, Durand E, Bebeacua C, et al. TssK is a trimeric cytoplasmic protein interacting with components of both phage-like and membrane anchoring complexes of the type VI secretion system. J Biol Chem. 2013 Sep 20;288(38):27031-27041. doi: 10.1074/jbc.M113.499772. Epub 2013 Aug 6. PMID: 23921384
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene) EC042_RS24275
Coordinate (Strand) 4879275..4879706 (+)
NCBI ID WP_001137932.1
RefSeq NC_017626
Uniprot ID D3GUX6_ECO44, A0A376XSP9_ECOLX
KEGG ID elo:EC042_4545
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 6.2e-15 32..114
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-143 MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTAHQLMRVLSDVLLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRYVQT


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9918 - -


  Protein sequence: 144 a.a.    

>T6CP005140 NC_017626:4879275-4879706 [Escherichia coli 042] [TssE]
MPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGTAHQLMRVLSDV
LLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQRYVQT*

  Nucleotide sequence: 432 bp    

>T6CP005140 NC_017626:4879275-4879706 [Escherichia coli 042] [TssE]
ATGCCGCGTCCTTCCCTTTATGAAATTCTCTATGGCAATTTCACTGGCGGGCTGGAGTTAAACCAGGTCGGTGAGGAAGA
GCAGGTTATTCTTTCGGTGCTCGATAACATGCAGCGTATTCTGAATACCCGTGCCGGAAGCCTTAAGCATCTTCCGGATT
ATGGTCTGCCGGATATAACAACCATTCTGCAGGGAATGCCGGGGACGGCGCATCAACTGATGCGCGTGCTTTCAGACGTT
CTGCTGAAGTATGAGCCACGTATTAAGCGCGTCGACGTGACGATGCAGGAACAGACTCAGCCTGGTGAGTTGCATTATGT
CATTGATGCAGAACTTAAAGATGCCGGGCTGGTTCGTTACGGAACAACATTTATACCGGAGGGCAGGGTGTTGTTGCGCC
ATCTGAAACAGCAGCGCTACGTGCAGACGTGA