Detailed information of component protein


Summary

Component ID T6CP004916
Component protein type IglE
T6SS ID (Type) T6SS00158 experimental (Type ii)
Strain Francisella tularensis subsp. novicida U112
Replicon chromosome
Sequence Protein sequence (126 a.a.); Nucleotide sequence (378 bp)
Reference
[1] de Bruin OM, Duplantis BN, Ludu JS, et al. The biochemical properties of the Francisella pathogenicity island (FPI)-encoded proteins IglA, IglB, IglC, PdpB and DotU suggest roles in type VI secretion. Microbiology (Reading). 2011 Dec;157(Pt 12):3483-3491. doi: 10.1099/mic.0.052308-0. Epub 2011 Oct 6. PMID: 21980115
[2] Robb CS, Nano FE, Boraston AB. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of intracellular growth locus E (IglE) protein from Francisella tularensis subsp. novicida. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2010 Dec 1;66(Pt 12):1596-8. doi: 10.1107/S1744309110034378. Epub 2010 Nov 25. PMID: 21139203
[3] Nano FE, Schmerk C. The Francisella pathogenicity island. Ann N Y Acad Sci. 2007 Jun;1105:122-37. Epub 2007 Mar 29. PMID: 17395722
[4] Bröms JE, Meyer L, Sun K, et al. Unique substrates secreted by the type VI secretion system of Francisella tularensis during intramacrophage infection. PLoS One. 2012;7(11):e50473. doi: 10.1371/journal.pone.0050473. Epub 2012 Nov 20. PMID: 23185631
[5] Barker JR, Chong A, Wehrly TD, et al. The Francisella tularensis pathogenicity island encodes a secretion system that is required for phagosome escape and virulence. Mol Microbiol. 2009 Dec;74(6):1459-70. PMID: 20054881
[6] Hare RF, Hueffer K. Francisella novicida pathogenicity island encoded proteins were secreted during infection of macrophage-like cells. PLoS One. 2014 Aug 26;9(8):e105773. doi: 10.1371/journal.pone.0105773. eCollection 2014. PMID: 25158041
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) FTN_RS06715
Coordinate (Strand) 1384032..1384409 (+)
NCBI ID WP_003040115.1
RefSeq NC_008601
Uniprot ID A0A2L1CHP2_FRANO, A0A6I4RY95_FRATU, A0Q7H2_FRATN
KEGG ID ftn:FTN_1311, ftx:AW25_693
PDB ID 5AMT, 5AMU

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-125 MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPLDKDIKDYALYFILPENKKTENWKYLISSDSVNEFTIKNDSSIEKD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9964 pos: 21-22. LSS-CI. MYNKLLKNLCLVLSTIIGLSS



  Protein sequence: 126 a.a.    

>T6CP004916 NC_008601:1384032-1384409 [Francisella tularensis subsp. novicida U112] [IglE]
MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPL
DKDIKDYALYFILPENKKTENWKYLISSDSVNEFTIKNDSSIEKD*

  Nucleotide sequence: 378 bp    

>T6CP004916 NC_008601:1384032-1384409 [Francisella tularensis subsp. novicida U112] [IglE]
ATGTACAATAAATTATTGAAAAATCTTTGTTTAGTATTATCCACAATCATAGGGCTTAGCAGTTGTATAAGTGATGGTTT
GTATATCAACAACAATATTCCTAAGACAAAAATAGTTCTAGAATCTAAACCTGATAAAAATATTTTCTACTCAGATAACT
ATCAATCTATTTCTCAAAGAATATATGATGATAATGTAAAAGTATTAAATCTTAAAACAGGAAAGAATGAATTTCCATTA
GATAAAGATATCAAGGATTATGCCTTGTATTTTATACTTCCTGAAAATAAAAAAACTGAAAACTGGAAATACCTAATAAG
TTCAGATTCTGTAAATGAATTTACTATAAAAAATGATAGCAGCATAGAAAAAGATTAA