Detailed information of component protein

Summary

Component ID	T6CP004828
Component protein type	IglE
T6SS ID (Type)	T6SS00466 (Type ii)
Strain	Francisella tularensis subsp. holarctica LVS
Replicon	chromosome
Sequence	Protein sequence (126 a.a.); Nucleotide sequence (378 bp)
Reference	[1] Bröms JE, Meyer L, Lavander M, et al. DotU and VgrG, core components of type VI secretion systems, are essential for Francisella LVS pathogenicity. PLoS One. 2012;7(4):e34639. doi: 10.1371/journal.pone.0034639. Epub 2012 Apr 13. PMID: 22514651 [2] de Bruin OM, Duplantis BN, Ludu JS, et al. The biochemical properties of the Francisella pathogenicity island (FPI)-encoded proteins IglA, IglB, IglC, PdpB and DotU suggest roles in type VI secretion. Microbiology (Reading). 2011 Dec;157(Pt 12):3483-3491. doi: 10.1099/mic.0.052308-0. Epub 2011 Oct 6. PMID: 21980115 [3] Bröms JE, Lavander M, Meyer L, et al. IglG and IglI of the Francisella pathogenicity island are important virulence determinants of Francisella tularensis LVS. Infect Immun. 2011 Sep;79(9):3683-96. doi: 10.1128/IAI.01344-10. Epub 2011 Jun 20. PMID: 21690239 [4] Nano FE, Schmerk C. The Francisella pathogenicity island. Ann N Y Acad Sci. 2007 Jun;1105:122-37. Epub 2007 Mar 29. PMID: 17395722 [5] Bröms JE, Meyer L, Sun K, et al. Unique substrates secreted by the type VI secretion system of Francisella tularensis during intramacrophage infection. PLoS One. 2012;7(11):e50473. doi: 10.1371/journal.pone.0050473. Epub 2012 Nov 20. PMID: 23185631 [6] Lindgren M, Bröms JE, Meyer L, et al. The Francisella tularensis LVS ΔpdpC mutant exhibits a unique phenotype during intracellular infection. BMC Microbiol. 2013 Jan 29;13:20. doi: 10.1186/1471-2180-13-20. PMID: 23356941 [7] Lindgren M, Eneslätt K, Bröms JE, et al. Importance of PdpC, IglC, IglI, and IglG for modulation of a host cell death pathway induced by Francisella tularensis. Infect Immun. 2013 Jun;81(6):2076-84. doi: 10.1128/IAI.00275-13. Epub 2013 Mar 25. PMID: 23529623 [8] Bröms JE, Meyer L, Sjöstedt A. A mutagenesis-based approach identifies amino acids in the N-terminal part of Francisella tularensis IglE that critically control Type VI system-mediated secretion. Virulence. 2017 Aug 18;8(6):821-847. doi: 10.1080/21505594.2016.1258507. Epub 2016 Nov 10. PMID: 27830989

Experimental investigation has been performed on this T6SS

---

External database links

Locus tag (Gene)	FTL_RS00615
Coordinate (Strand)	118185..118562 (-)
NCBI ID	WP_003018235.1
RefSeq	NC_007880
Uniprot ID	A0A0B3VVQ1_FRATU, A0A7M1PTI5_FRATU
KEGG ID	ftv:CH67_381, ftz:CH68_118, ftc:DA46_1619, ftz:CH68_1259, ftc:DA46_612, ftv:CH67_1527
PDB ID	-

---

Pfam domain hit(s)

Domain	Pfam ID	E-value	Aligned region

---

Transmembrane helices

• Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction	Region	Sequence
Outside	1-125	MYNKLLKNLCLVLSTIIGLSSCISDGLYINNNIPKTKIVLESKPDKNIFYSDNYQSISQRIYDDNVKVLNLKTGKNEFPLDKDIKDYALYFILPENKKTENWKYIISSDSVNKFTIKNDSSIEKD

---

Signal peptides

Prediction	Probability	Cleavage site	Signal peptide sequence
LIPO(Sec/SPII)	0.9964	pos: 21-22. LSS-CI.	MYNKLLKNLCLVLSTIIGLSS

---

  Protein sequence: 126 a.a.    Download


  Nucleotide sequence: 378 bp    Download