Detailed information of component protein


Summary

Component ID T6CP004823
Component protein type TssL
T6SS ID (Type) T6SS00466 experimental (Type ii)
Strain Francisella tularensis subsp. holarctica LVS
Replicon chromosome
Sequence Protein sequence (208 a.a.); Nucleotide sequence (624 bp)
Reference
[1] Bröms JE, Meyer L, Lavander M, et al. DotU and VgrG, core components of type VI secretion systems, are essential for Francisella LVS pathogenicity. PLoS One. 2012;7(4):e34639. doi: 10.1371/journal.pone.0034639. Epub 2012 Apr 13. PMID: 22514651
[2] de Bruin OM, Duplantis BN, Ludu JS, et al. The biochemical properties of the Francisella pathogenicity island (FPI)-encoded proteins IglA, IglB, IglC, PdpB and DotU suggest roles in type VI secretion. Microbiology (Reading). 2011 Dec;157(Pt 12):3483-3491. doi: 10.1099/mic.0.052308-0. Epub 2011 Oct 6. PMID: 21980115
[3] Bröms JE, Lavander M, Meyer L, et al. IglG and IglI of the Francisella pathogenicity island are important virulence determinants of Francisella tularensis LVS. Infect Immun. 2011 Sep;79(9):3683-96. doi: 10.1128/IAI.01344-10. Epub 2011 Jun 20. PMID: 21690239
[4] Nano FE, Schmerk C. The Francisella pathogenicity island. Ann N Y Acad Sci. 2007 Jun;1105:122-37. Epub 2007 Mar 29. PMID: 17395722
[5] Bröms JE, Meyer L, Sun K, et al. Unique substrates secreted by the type VI secretion system of Francisella tularensis during intramacrophage infection. PLoS One. 2012;7(11):e50473. doi: 10.1371/journal.pone.0050473. Epub 2012 Nov 20. PMID: 23185631
[6] Lindgren M, Bröms JE, Meyer L, et al. The Francisella tularensis LVS ΔpdpC mutant exhibits a unique phenotype during intracellular infection. BMC Microbiol. 2013 Jan 29;13:20. doi: 10.1186/1471-2180-13-20. PMID: 23356941
[7] Lindgren M, Eneslätt K, Bröms JE, et al. Importance of PdpC, IglC, IglI, and IglG for modulation of a host cell death pathway induced by Francisella tularensis. Infect Immun. 2013 Jun;81(6):2076-84. doi: 10.1128/IAI.00275-13. Epub 2013 Mar 25. PMID: 23529623
[8] Bröms JE, Meyer L, Sjöstedt A. A mutagenesis-based approach identifies amino acids in the N-terminal part of Francisella tularensis IglE that critically control Type VI system-mediated secretion. Virulence. 2017 Aug 18;8(6):821-847. doi: 10.1080/21505594.2016.1258507. Epub 2016 Nov 10. PMID: 27830989
experimental Experimental investigation has been performed on this T6SS
External database links

Locus tag (Gene) FTL_RS00590
Coordinate (Strand) 113341..113964 (-)
NCBI ID WP_003016181.1
RefSeq NC_007880
Uniprot ID A0A0B3VP77_FRATU, Q5NED1_FRATT, A0A0E2ZL94_FRATU
KEGG ID ftv:CH67_376, ftu:FTT_1706, ftc:DA46_617, ftu:FTT_1351, ftc:DA46_1624, ftv:CH67_1522, ftz:CH68_1253, ftz:CH68_113
PDB ID -
Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 6.6e-10 24..201
Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-185 MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKSASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENSTIDSVNFIDIPVNSPPLSRKYSKTLK
Transmembrane helix 186-205 FLLRIGVPLGLFLLSLLILL
Outside 206-207 SW


Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9957 - -


  Protein sequence: 208 a.a.    

>T6CP004823 NC_007880:c113964-113341 [Francisella tularensis subsp. holarctica LVS] [TssL]
MKDFKEIEIILDIIKTTREIIEDNDNDNEKISYHRNNIRKSIFFLQEELLEKYSETVCKYIVFPLLAYVDEKLMLLREKS
ASNISWSLLQLEYYDRKDGGEYVFEITDNILSENIYPEICYQTISLILHNDFYGKYYDNIYNHSFLAYKKEIDKHIENST
IDSVNFIDIPVNSPPLSRKYSKTLKFLLRIGVPLGLFLLSLLILLSW*

  Nucleotide sequence: 624 bp    

>T6CP004823 NC_007880:c113964-113341 [Francisella tularensis subsp. holarctica LVS] [TssL]
ATGAAAGACTTTAAAGAGATAGAAATTATTCTAGATATTATAAAAACTACAAGAGAAATTATAGAAGATAATGATAATGA
TAATGAGAAAATATCATACCATCGTAATAATATAAGAAAAAGTATTTTCTTCCTACAAGAAGAGCTCTTAGAAAAATATA
GTGAAACTGTCTGTAAATATATAGTTTTTCCGTTACTTGCATATGTTGATGAAAAATTGATGCTACTTAGGGAAAAGTCA
GCAAGCAATATTTCTTGGAGTCTATTACAATTAGAATATTATGATAGAAAAGATGGCGGTGAATATGTTTTTGAGATAAC
TGATAATATTTTATCAGAGAATATCTATCCAGAAATTTGCTACCAGACAATATCACTTATCCTACACAATGACTTCTATG
GCAAATACTATGACAATATATATAACCATAGCTTTCTTGCTTATAAGAAAGAAATTGATAAGCATATAGAAAATTCGACA
ATTGATTCGGTTAATTTTATTGATATACCCGTTAATAGCCCCCCACTGTCAAGAAAATATAGTAAGACGCTTAAATTCTT
ATTAAGAATAGGCGTTCCTTTAGGACTGTTTCTTTTAAGCTTACTAATTTTATTAAGCTGGTAA