Detailed information of component protein
Summary
| Component ID | T6CP003914 |
| Component protein type | TssE |
| T6SS ID (Type) | T6SS00382 |
| Strain | Xenorhabdus bovienii SS-2004 |
| Replicon | chromosome |
| Sequence | Protein sequence (185 a.a.); Nucleotide sequence (555 bp) |
| Reference |
External database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2059309..2059863 (-) |
| NCBI ID | WP_012988551.1 |
| RefSeq | NC_013892 |
| Uniprot ID | D3V3B0_XENBS |
| KEGG ID | xbo:XBJ1_2099 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-184 | MKDNITLLHGGYHFRKPPARITARDRMQSSLLDRLTDNEPDKKKENMNNYLLSHRTFRQNVLRDLQWLLNSINKEPNQDFSCFPEIQRSAYNFGIAPLAGKNISDIEWSDIQNKIIKAIHIFEPRIIPNELQVNCISDIRSLSLYNTLSIEIKGFLWCIPWPIEFLFRSNLDLEHGYFTMKEAG |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9852 | - | - |
Protein sequence: 185 a.a.
Nucleotide sequence: 555 bp