Detailed information of component protein


Summary

Component ID T6CP003914
Component protein type TssE
T6SS ID (Type) T6SS00382 experimental (Type i3)
Strain Xenorhabdus bovienii SS-2004
Replicon chromosome
Sequence Protein sequence (185 a.a.); Nucleotide sequence (555 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene)
Coordinate (Strand) 2059309..2059863 (-)
NCBI ID WP_012988551.1
RefSeq NC_013892
Uniprot ID D3V3B0_XENBS
KEGG ID xbo:XBJ1_2099
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-184 MKDNITLLHGGYHFRKPPARITARDRMQSSLLDRLTDNEPDKKKENMNNYLLSHRTFRQNVLRDLQWLLNSINKEPNQDFSCFPEIQRSAYNFGIAPLAGKNISDIEWSDIQNKIIKAIHIFEPRIIPNELQVNCISDIRSLSLYNTLSIEIKGFLWCIPWPIEFLFRSNLDLEHGYFTMKEAG



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9852 - -



  Protein sequence: 185 a.a.    


  Nucleotide sequence: 555 bp