Detailed information of component protein


Summary

Component ID T6CP003809
Component protein type TssE
T6SS ID (Type) T6SS00372 experimental (Type i4b)
Strain Edwardsiella tarda EIB202
Replicon chromosome
Sequence Protein sequence (159 a.a.); Nucleotide sequence (477 bp)
Reference
[1] Yang M, Lv Y, Xiao J, et al. Edwardsiella comparative phylogenomics reveal the new intra/inter-species taxonomic relationships, virulence evolution and niche adaptation mechanisms. PLoS One. 2012;7(5):e36987. doi: 10.1371/journal.pone.0036987. Epub 2012 May 10. PMID: 22590641
[2] Lv Y, Xiao J, Liu Q, et al. Systematic mutation analysis of two-component signal transduction systems reveals EsrA-EsrB and PhoP-PhoQ as the major virulence regulators in Edwardsiella tarda. Vet Microbiol. 2012 May 25;157(1-2):190-9. doi: 10.1016/j.vetmic.2011.12.018. Epub 2011 Dec 22. PMID: 22227416
[3] Chakraborty S, Sivaraman J, Leung KY, et al. Two-component PhoB-PhoR regulatory system and ferric uptake regulator sense phosphate and iron to control virulence genes in type III and VI secretion systems of Edwardsiella tarda. J Biol Chem. 2011 Nov 11;286(45):39417-30. doi: 10.1074/jbc.M111.295188. Epub 2011 Sep 27. PMID: 21953460
[4] Leung KY, Siame BA, Tenkink BJ, et al. Edwardsiella tarda - virulence mechanisms of an emerging gastroenteritis pathogen. Microbes Infect. 2012 Jan;14(1):26-34. doi: 10.1016/j.micinf.2011.08.005. Epub 2011 Sep 1. PMID: 21924375
[5] Jobichen C, Chakraborty S, Li M, et al. Structural basis for the secretion of EvpC: a key type VI secretion system protein from Edwardsiella tarda. PLoS One. 2010 Sep 23;5(9):e12910. doi: 10.1371/journal.pone.0012910. PMID: 20886112
[6] Wang X, Wang Q, Xiao J, et al. Hemolysin EthA in Edwardsiella tarda is essential for fish invasion in vivo and in vitro and regulated by two-component system EsrA-EsrB and nucleoid protein HhaEt. Fish Shellfish Immunol. 2010 Dec;29(6):1082-91. doi: 10.1016/j.fsi.2010.08.025. Epub 2010 Sep 9. PMID: 20832475
[7] Wang X, Wang Q, Xiao J, et al. Edwardsiella tarda T6SS component evpP is regulated by esrB and iron, and plays essential roles in the invasion of fish. Fish Shellfish Immunol. 2009 Sep;27(3):469-77. doi: 10.1016/j.fsi.2009.06.013. Epub 2009 Jun 27. PMID: 19563898
[8] Zheng J, Leung KY. Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 2007 Dec;66(5):1192-206. Epub 2007 Nov 6. PMID: 17986187
[9] Zhang J, Xiao J, Zhang Y, et al. A new target for the old regulator: H-NS suppress T6SS secretory protein EvpP, the major virulence factor in the fish pathogen Edwardsiella tarda. Lett Appl Microbiol. 2014 Nov;59(5):557-64. doi: 10.1111/lam.12316. Epub 2014 Sep 12. PMID: 25131176
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ETAE_RS11260
Coordinate (Strand) 2559257..2559733 (+)
NCBI ID WP_015461951.1
RefSeq NC_013508
Uniprot ID A0A411H566_9GAMM, Q6EE17_EDWTA, A0A0H3DV25_EDWTF
KEGG ID etd:ETAF_2203
PDB ID -

Pfam domain hit(s)

Loading, please wait
Domain
Pfam ID
E-value
Aligned region
GPW_gp25PF04965.161.1e-1938..136
Showing 1 to 1 of 1 rows

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Loading, please wait
Prediction                
Region    
Sequence
Outside1-158MILRHLFRPSVLDRLFDDFPQERTERTSDRRYDLAHFRWAVRRDVEDVLNTRSALSLDIDQWPELEKSPLNYGLPDCSNLSAANAEDREWIRQHIERAIDLFEPRLSQVRVHIHLDEKTGISQLIFRIEALLDVDPSPEPVMFDAVLDVSTQLYRIDR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Loading, please wait
Prediction       
Probability
Cleavage site
Signal peptide sequence
Other0.9953--



  Protein sequence: 159 a.a.    

>T6CP003809 NC_013508:2559257-2559733 [Edwardsiella tarda EIB202] [TssE]
MILRHLFRPSVLDRLFDDFPQERTERTSDRRYDLAHFRWAVRRDVEDVLNTRSALSLDIDQWPELEKSPLNYGLPDCSNL
SAANAEDREWIRQHIERAIDLFEPRLSQVRVHIHLDEKTGISQLIFRIEALLDVDPSPEPVMFDAVLDVSTQLYRIDR*

  Nucleotide sequence: 477 bp    

>T6CP003809 NC_013508:2559257-2559733 [Edwardsiella tarda EIB202] [TssE]
ATGATCCTTCGCCATCTCTTCCGCCCCTCCGTGCTGGATCGTCTGTTCGATGATTTCCCACAGGAGCGAACCGAACGGAC
ATCAGACCGTCGGTATGACCTGGCCCACTTTCGCTGGGCCGTCCGACGGGATGTGGAGGATGTCCTGAATACGCGATCCG
CGCTGTCGCTGGATATCGATCAGTGGCCTGAGCTGGAAAAGTCCCCCCTGAATTACGGCCTGCCGGACTGCTCCAACCTG
AGCGCCGCCAACGCCGAGGATCGGGAGTGGATCCGCCAGCATATCGAGCGGGCCATCGATCTGTTTGAACCCCGGCTGAG
CCAGGTCCGGGTGCACATCCATCTGGATGAGAAAACCGGCATCAGCCAGCTGATCTTCAGGATCGAGGCATTACTGGACG
TCGATCCCTCGCCGGAGCCGGTGATGTTCGATGCCGTGCTGGATGTTTCAACACAGCTGTACCGAATAGACAGGTGA