Detailed information of component protein


Summary

Component ID T6CP003754
Component protein type TssJ
T6SS ID (Type) T6SS00367 insolico (Type i1)
Strain Escherichia coli O111:H- str. 11128
Replicon chromosome
Sequence Protein sequence (175 a.a.); Nucleotide sequence (525 bp)
Reference
-
insolico Bioinformatics investigation has been performed on this T6SS

External database links

Locus tag (Gene) ECO111_RS01175
Coordinate (Strand) 253834..254358 (-)
NCBI ID WP_001080149.1
RefSeq NC_013364
Uniprot ID A0A070FAC0_ECOLX, A0A073G2Y1_ECOLX, A0A073HUE5_ECOLX, A0A073UDG6_ECOLX, A0A074IAW4_ECOLX, A0A080GCU4_ECOLX, A0A0E0TUU6_ECOLX, A0A0E0Y3I7_ECO1C, A0A170V2Y9_KLEOX, A0A1X3IBC4_ECOLX, A0A1X3JMG5_ECOLX, A0A222QGU2_ECOLX, A0A236UEC4_SHIBO, A0A365Q5G1_ECOLX, A0A3D8XN76_9ENTR, A0A4S5AM96_ECOLI, A0A556Y232_ECOLX, A0A5B7MUI0_ECOLX, A0A6C8HNY0_ECOLX, A0A6H2GI60_9ESCH, A0A6I4KN30_9ENTR, A0A7M3S2E7_ECOHS, B7LHD2_ECO55, B8ZYU5_ECOLX, C8UH86_ECO1A, D6HSD1_ECOLX, D7XRE2_ECOLX, D7ZKP6_ECOLX, D8E9T8_ECOLX, E0J661_ECOLW, E1IY72_ECOLX, E1JBR7_ECOLX, E6BQF9_ECOLX, E9XQ99_ECOLX, F4V9Z9_ECOLX, I2UQI0_ECOLX, I2WT34_ECOLX, K4USI1_ECOLX, L3QIQ2_ECOLX, U9YST7_ECOLX, V0YIZ7_ECOLX, V6FQD0_ECOLX, V8K746_ECOLX, W1ES33_ECOLX
KEGG ID elw:ECW_m0225, eoi:ECO111_0226, eck:EC55989_0226, eun:UMNK88_235, esl:O3K_20450
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 8.9e-23 45..164

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
- -



  Protein sequence: 175 a.a.    

>T6CP003754 NC_013364:c254358-253834 [Escherichia coli O111:H- str. 11128] [TssJ]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKL
LAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLV
HVRQSSIEMKKEDE*

  Nucleotide sequence: 525 bp    

>T6CP003754 NC_013364:c254358-253834 [Escherichia coli O111:H- str. 11128] [TssJ]
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAAAAATCAGTGA
GGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAACCGTCACCCTGCTGACCGAAC
CGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAACTGGTGTACCTGACTGACGACTCAAAATTG
CTGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTACCGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTT
CAACCTGTTGCCGGACACCATCAAAACCCTGCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCT
ATTTCTCCGATGACCAGGCCACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTG
CATGTACGTCAAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA