Detailed information of component protein
Summary
| Component ID | T6CP003515 |
| Component protein type | TssA |
| T6SS ID (Type) | T6SS00346  (Type i4b) |
| Strain | Edwardsiella ictaluri 93-146 |
| Replicon | chromosome |
| Sequence | Protein sequence (357 a.a.); Nucleotide sequence (1071 bp) |
| Reference |
Experimental investigation has been performed on this T6SSExternal database links
| Locus tag (Gene) | |
| Coordinate (Strand) | 2644120..2645190 (+) |
| NCBI ID | WP_015872016.1 |
| RefSeq | NC_012779 |
| Uniprot ID | C5BAE5_EDWI9 |
| KEGG ID | eic:NT01EI_2747 |
| PDB ID | - |
Pfam domain hit(s)
| Domain | Pfam ID | E-value | Aligned region |
|---|
Transmembrane helices
- Transmembrane helices are predicted using TMHMM 2.0 software.
| Prediction | Region | Sequence |
|---|---|---|
| Outside | 1-356 | MNILDMARLLAPISEHHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQSNWAEVIRLASEALETRSKDLQLAVWLCEALVQRHGLPGLQEGLLLLDNLLEHYWAEMYPELTEGELEGRVSRLEWLNQVLPPVLGLLPLTAAQDRRAYGWLDWQASREVDNLKRLNNEAAQTALGEGKTDPDAWDLAVSHTPGTFYLTLQSDLQQAISAFQGLSQRLDPLFGRDVPRISNVAERLEQMLRLVTRLVEGKGMTVTNGTGENPLTPAGTEAIPVVTTSSPGVAGAPRTREEAIQQLNGIATFFRETEPHSPVSYIVDKAVRWGNMRLDEWIREVVDDNGTRRMLKGVLGYDEE |
Signal peptides
- Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
- Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
- Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
| Prediction | Probability | Cleavage site | Signal peptide sequence |
|---|---|---|---|
| Other | 0.9936 | - | - |
Protein sequence: 357 a.a.
Nucleotide sequence: 1071 bp