Detailed information of component protein


Summary

Component ID T6CP003165
Component protein type TssB
T6SS ID (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (168 a.a.); Nucleotide sequence (504 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ABBFA_RS11060
Coordinate (Strand) 2386100..2386603 (-)
NCBI ID WP_001119042.1
RefSeq NC_011595
Uniprot ID A0A0R1C0C6_ACINO, A0A7U4F6E1_ACIBA, A0A829KE09_ACIBA, A0A0J1D543_ACIBA, A0A3R9GCK7_9GAMM, A0A7U3XZ96_ACIBC, R9RIN9_ACIBA, A0A7U3Y5I2_ACIB5, A0A654KXY3_ACIBM, B0VB05_ACIBY, A0A828SP91_ACIBA, A0A5K6CSB6_ACIB3, D0C8P5_ACIB2, L9MHM8_9GAMM, A0A385EU23_ACIBA
KEGG ID abw:BL01_13275, abz:ABZJ_01454, aby:ABAYE2415, abc:ACICU_01296, abh:M3Q_1665, abn:AB57_1479, abb:ABBFA_02209
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 1e-59 12..164

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-167 MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9973 - -



  Protein sequence: 168 a.a.    

>T6CP003165 NC_011595:c2386603-2386100 [Acinetobacter baumannii AB307-0294] [TssB]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNIDEVMESLSPR
AAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKL
SAEADHE*

  Nucleotide sequence: 504 bp    

>T6CP003165 NC_011595:c2386603-2386100 [Acinetobacter baumannii AB307-0294] [TssB]
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATGATGTCGAAAT
TGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTCAGCTGCATCTGAGCTTGAGC
GTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATTGATGAAGTAATGGAATCTCTGTCTCCAAGA
GCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCGGTAAAATGGCTGTTGATTTAACGTTTAAGTCAATGGAAGA
TTTTCGCCCGGAAAATGTTGTACAGCAAGTTGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAA
GAAACAAAATTTCAAACAGTGAGCGTTTAGAAGACCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTA
AGTGCGGAGGCCGATCATGAATAA