Detailed information of component protein


Summary

Component ID T6CP003155
Component protein type TssL
T6SS ID (Type) T6SS00312 experimental (Type i4b)
Strain Acinetobacter baumannii AB307-0294
Replicon chromosome
Sequence Protein sequence (269 a.a.); Nucleotide sequence (807 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) ABBFA_RS10990
Coordinate (Strand) 2367193..2367999 (-)
NCBI ID 446005774
RefSeq NC_011595
Uniprot ID A0A0J0ZX80_ACIBA, V5VEM3_ACIBA, B0VB14_ACIBY, D0C8N1_ACIB2
KEGG ID aby:ABAYE2401
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 1.8e-51 35..237

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-216 MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELP
Transmembrane helix 217-239 FFWILIFLLIFALLTFAGLRFML
Inside 240-268 NNQNDKALSNYQNVISAPQEQAHITIYLP



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9868 - -



  Protein sequence: 269 a.a.    

>T6CP003155 NC_011595:c2367999-2367193 [Acinetobacter baumannii AB307-0294] [TssL]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLNRFEQQAKKLQ
FSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILEQLRSRGKERLAALEVFHYCL
LLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELPFFWILIFLLIFALLTFAGLRFMLN
NQNDKALSNYQNVISAPQEQAHITIYLP*

  Nucleotide sequence: 807 bp    

>T6CP003155 NC_011595:c2367999-2367193 [Acinetobacter baumannii AB307-0294] [TssL]
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATAGCCAGTCCCA
AGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTTTTTAATTCGAAATCAGTATG
TGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAATCGATTTGAGCAACAAGCGAAAAAGTTACAA
TTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTTGTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCC
AAGCTATTTTAATTTACAAAATTCTTGGTTAATTAGCCCATTACAGTTAAGTCTGTTTGGTTCTCAGTTAGCGGGTTATC
AATTCTTCGAAATTTTAGAGCAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTA
TTATTAGGTTTTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATTATCCATCGTG
AGCTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAGGTTTAAGATTTATGCTTAAC
AATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCCACAAGAGCAGGCACATATTACTATTTACTT
ACCTTGA