Detailed information of component protein


Summary

Component ID T6CP002556
Component protein type TssE
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (160 a.a.); Nucleotide sequence (480 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07520
Coordinate (Strand) 1652892..1653371 (+)
NCBI ID WP_002209686.1
RefSeq NC_010465
Uniprot ID A0A0E8XPJ3_9GAMM, A0A0H2YI41_YERPN, A0A0H3B3J0_YERPY, A0A0T9JCT6_YERPU, A0A0U1R3C0_YERP3, A0A2U2H0H3_YERPE, A0A656FFD3_YERPE, A0A6B3SWC1_YERPE, Q668T2_YERPS
KEGG ID ypy:YPK_1490, ype:YPO2728, ypq:DJ40_3888, ypm:YP_2437, ypj:CH55_4155, ypw:CH59_3614, yps:YPTB2655, ypn:YPN_2219, ypo:BZ17_3983, ypi:YpsIP31758_1378, ypv:BZ15_798, ypu:BZ21_1952, ypk:y1561, ypc:BZ23_2236, ypr:BZ20_3554, ypl:CH46_2374
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
GPW_gp25 PF04965.16 1.9e-16 37..136

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-159 MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSVLNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPIDLCIEGAYDVETDNAELRAR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9924 - -



  Protein sequence: 160 a.a.    

>T6CP002556 NC_010465:1652892-1653371 [Yersinia pseudotuberculosis YPIII] [TssE]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSVLNYGISPLVG
LYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPIDLCIEGAYDVETDNAELRAR*

  Nucleotide sequence: 480 bp    

>T6CP002556 NC_010465:1652892-1653371 [Yersinia pseudotuberculosis YPIII] [TssE]
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATATTGAGCCTCA
CGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGAGATATTAAATAATGCCAATA
TTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTCTTAAACTATGGTATTTCACCCTTGGTTGGG
CTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAATTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAAT
GGCGGAATCTCTCGTTGTCAGCCAGCAACTCCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAAT
GGAACCCGCACCCTATCGATCTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA