Detailed information of component protein


Summary

Component ID T6CP002554
Component protein type TssM
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (1276 a.a.); Nucleotide sequence (3828 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07495
Coordinate (Strand) 1643872..1647699 (+)
NCBI ID WP_011192705.1
RefSeq NC_010465
Uniprot ID Q668S7_YERPS, A0A0U1QXG0_YERP3, A0A0H3B3I5_YERPY
KEGG ID ypy:YPK_1485, ypo:BZ17_3978, ypi:YpsIP31758_1373, yps:YPTB2660
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
IcmF-related_N PF14331.8 6.7e-76 253..535
IcmF-related PF06761.14 1.6e-68 586..898
IcmF_C PF06744.14 1.1e-16 1144..1247

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-15 MSYLNRLFSGWAMKR
Transmembrane helix 16-38 ILLVGCFILLAAAIWFLGPFLGF
Outside 39-47 GEARPLESY
Transmembrane helix 48-67 EARIICILLALLLILGFWYG
Inside 68-71 APRF
Transmembrane helix 72-91 VIAAVVACAAVWVIGPFILV
Outside 92-100 GDDHPLTDG
Transmembrane helix 101-123 IRRGIIIAIIAFITLIYGTWCLV
Inside 124-528 KALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISSRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWSGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVTFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQNVFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQN
Transmembrane helix 529-548 LLGHAACIGLAVWLVWAFLV
Outside 549-1275 SFQHNEGYLQATGAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVEHQSEVALRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADAPGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNGIW



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9630 - -



  Protein sequence: 1276 a.a.    

>T6CP002554 NC_010465:1643872-1647699 [Yersinia pseudotuberculosis YPIII] [TssM]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPRFVIAAVVACA
AVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHKKAAKPEAEAELSEVNAMIRN
GMNYVRRIHSGIPAWRRFFISSRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGKENPPTQHCECLFSNDAL
FLDTSGKYIDDSKDNQTEWSGILKALKKYRPVKAINGVIVAISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVY
VTITKLDQLSGFDEYFRNLTAEDREQIWGVTFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGM
YALPQDFRMLSQRVTEVLQNVFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQK
SDNEDRFISDVAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVEH
QSEVALRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLKDWRQYGQ
PADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDELLHEGIPGLYTYAGYHEVVKK
KLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLV
SENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADA
PGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKV
ITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAF
FEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKAS
AMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNGIW*

  Nucleotide sequence: 3828 bp    

>T6CP002554 NC_010465:1643872-1647699 [Yersinia pseudotuberculosis YPIII] [TssM]
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATATTGCTGGCTGC
GGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTATGAAGCCAGAATTATTTGCA
TCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGCTTTGTCATTGCCGCCGTCGTTGCCTGTGCT
GCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATGATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTAT
CGCCATCATTGCATTTATTACACTTATTTATGGTACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGG
ATAACTTCATTAAGCACAAGAAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAAT
GGCATGAACTATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAGCCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAGGACTTTCCTT
TACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTTTGTTCTCTAATGACGCCCTG
TTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGACTGAGTGGAGCGGGATATTAAAGGCACTCAA
AAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTCGCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTG
ATTTACTGAATGTGTCGGCGACGCTACGCACGCGTTTGGATGAGGTACGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTAT
GTCACGATTACAAAACTGGATCAATTATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAAT
TTGGGGGGTGACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAGAAAAGGCATG
TATGCACTCCCCCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAATGTTTTCTTCGCCTCACGCTT
TGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCAGTTGTCAGCCTGCGGATGTTGAACTGTTAA
ATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAATCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAA
AGTGATAATGAAGATCGGTTTATCAGCGATGTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGAT
TACCAAAGATGCCGACTTAGTCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGG
CTTGTATTGGGTTGGCAGTTTGGTTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTACCTGCGTTATT
GAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGACTGGCGTTATGGCTTATATA
CCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTGCAAAAATATCTCTTCCCAATGGTTGAGCAT
CAGAGTGAGGTTGCATTAAGAAAAACGATGCACTCAGGTCAGAGCGAAGAGGTTTATGCCGCGTTGAAGCTTTATTTGAT
GCTGACGGGTGAAGGTAAATTTGATCGTCAATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTG
AGCCTTACGAAGAGAAGAGTATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTACGGGCAA
CCGGCAGACAGTGAACTGATTAAGCAGGCTCGGGCAATATTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACACAGGTATTCA
CCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCAGGGCTTTATACCTACGCGGGTTACCATGAGGTGGTTAAAAAA
AAACTGACACCTTTGCTGATGTTACTTCAAGAAGAGGATAGGTGGGTGATGGCGCAATCGCTGTCATCTTCTCTTGACCC
ATTGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAAGGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTTC
GTCTGATTTCTGTCGATGCGGACAGTGCAGAGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAAGGACGTTAGTT
TCAGAAAATTCACCGCTACTCAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGCCGAAAAAGAAAAAGCCATTAC
TGATGAGATAAACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAA
ATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAGTGCTGATGCC
CCGGGGGGCAATAATCTTTCTGTTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACATTAAACGATCAATATACGCG
TTTTGTTGTTTATAACAGTGCCTTTGAATATGGCGATATCCCTCCGTTATCCCAGGATGGGGAACGTATTGCGGTGGAAT
CACAAACGTGGCCGGATCCGTTTAGAAATATTATTGCACCGTTATTAACGGGCTCATCTCAGAAATTTGAAAATAAAGTG
ATTACTCACACGTCCAAAGCGATTGATATGGGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGTTATCCATTTGC
TGAAAGTGAGCAAATTGTTAGTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTACGGTGGACAGTTATTTCAAGA
AAAACTTGGAGAGTAAAGTCGACACCTCCTCAATACCTTGGCGTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTC
TTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAATACCAATGACGGTAAAAAAATGGCATTAGATTTTTCCGTATC
AGTGCGTTATTTAGCACCCACTATCACCCAACTTATTATGAATTTTGATGGTAATACTGTGCGTTATTCCCATGGTCCCG
TAACGCCTGCCTTCTTTAAATGGCCGGGTTTACGTCAAGGCACCATTGTCAGTTTAACGGCCCAACGCCAGAAGGCATCC
GCGATGCCCGATATTCTTTTTCGCGGACCTTGGGCACTCTTGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAGC
GAATGGCAAACAGACGCTGACTTATCTCATGGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAACGCATGGTGGTG
AAACCATTAGCGATCTGCTGAGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGTATTTGGTAA