Detailed information of component protein


Summary

Component ID T6CP002553
Component protein type TssL
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (459 a.a.); Nucleotide sequence (1377 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07490
Coordinate (Strand) 1642487..1643863 (+)
NCBI ID WP_011192706.1
RefSeq NC_010465
Uniprot ID A0A0H3B2I1_YERPY, A0A3G5L467_YERPU, Q668S6_YERPS
KEGG ID ypc:BZ23_2242, ypo:BZ17_3977, ypu:BZ21_1958, yps:YPTB2661, ypy:YPK_1484
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
DotU PF09850.11 3e-48 86..289
OmpA PF00691.22 7.1e-17 352..450

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-270 MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPMTYPDSTQDNAAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFVPVR
Transmembrane helix 271-293 VSMLLCGFLIVATFIGCKYFLSV
Inside 294-458 PESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9850 - -



  Protein sequence: 459 a.a.    

>T6CP002553 NC_010465:1642487-1643863 [Yersinia pseudotuberculosis YPIII] [TssL]
MSDSSDLNLGGSMPPFDQSRNVDESPQALGRFLLDEPMTYPDSTQDNAAFTREAPHSGAAQQYDTTLLRGESVQQRVAKV
LASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWG
MMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQS
TRDTIPPALSPHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPN
NQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY*

  Nucleotide sequence: 1377 bp    

>T6CP002553 NC_010465:1642487-1643863 [Yersinia pseudotuberculosis YPIII] [TssL]
ATGAGTGACAGCAGTGATTTGAACCTTGGGGGCTCAATGCCTCCTTTTGATCAAAGCAGAAATGTGGATGAGAGTCCGCA
GGCATTAGGCCGGTTCTTGCTTGATGAACCAATGACATACCCAGATAGCACTCAGGATAATGCGGCCTTCACTAGAGAGG
CCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTTACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTA
CTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCACTATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGA
TGTTTCACAGGTTCATATATTAAAACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATA
TCTCATGGAAAAAAATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGA
ATGATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGGCTCGGTTTTG
AGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGT
ACCCGAGACACGATCCCTCCGGCACTTTCTCCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGT
TCCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTAC
CGGAAAGTGACTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCAAAGTCATCTT
TAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGTAATTAAACGCGTCGCGCAGG
AAGTGCATCGCGTTAAAGGGGCAATCCTCATTGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGGCTTCCCTAAT
AACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCACGCTATATGGAACAGGCCGGTATTCCAACCGACAAAATTCG
GTTTGAGGGCAAGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAA
TTTTTGTTAATTATTGA