Detailed information of component protein


Summary

Component ID T6CP002552
Component protein type TssK
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (450 a.a.); Nucleotide sequence (1350 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07485
Coordinate (Strand) 1641141..1642490 (+)
NCBI ID WP_002211571.1
RefSeq NC_010465
Uniprot ID A0A0E1NWA0_YERPA, A0A0H2YID3_YERPN, A0A0H3B1M0_YERPY, A0A0U1R0Q3_YERP3, A0A3G5IZL1_YERPU, A0A5P8YHX0_YERPE, A0A656FGY0_YERPE, A0A6B3T8L9_YERPE, Q668S5_YERPS
KEGG ID ypy:YPK_1483, ypl:CH46_2170, ypw:CH59_3139, ypn:YPN_1446, ypu:BZ21_1959, ypa:YPA_2126, yps:YPTB2662, ypi:YpsIP31758_1371, ypo:BZ17_3976, ypm:YP_2761, ypv:BZ15_596, ypj:CH55_4144, ypk:y1549, ype:YPO2934, ypc:BZ23_2243, ypr:BZ20_3547, ypq:DJ40_3881
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VasE PF05936.14 1.3e-141 19..446

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-449 VRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPDGTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLLLQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWDKVSNAGAIALHVAGDFPALKMELWGIRDS



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9873 - -



  Protein sequence: 450 a.a.    

>T6CP002552 NC_010465:1641141-1642490 [Yersinia pseudotuberculosis YPIII] [TssK]
VRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPDGTPFDIPGHA
ELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSSLARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMT
ESWIGLPLTKVRAIQPDGSVLLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLL
LQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYASIRPLVDEVHELLNQILVRA
GQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQ
IPYSAGYVYFELIKNGPFWDKVSNAGAIALHVAGDFPALKMELWGIRDS*

  Nucleotide sequence: 1350 bp    

>T6CP002552 NC_010465:1641141-1642490 [Yersinia pseudotuberculosis YPIII] [TssK]
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGGCTTTTTCTTCGCCCACAACTTTTTCAACAGCAAGAGCGCTATCTTGA
ATATTACGCCCATAAGCGAGCGGCAACGATAACCCCATTCTTTTGGGGATTTGCGCAATATGAAATTGATAGAGAAGCGC
TCTCGTATGGCAAATTAGTATTGCGATCTGGGAAGGGCGTGTTACCCGACGGTACACCATTTGATATTCCCGGCCATGCT
GAATTGCCTGAACCGCTCACTATCACCCCAGAACATCTGGGTAAGTTGATCTATCTGGCGGTCCCACTGCGCCTGGATAA
CAGTGATGAAACCATTTTTGATGAGCACGATATGAGCTCATTGGCACGTTTTTACGCCTATGAAGCTGCGCTCAACGATA
CCAATGCCATTCGGCAAGGGCCGAAGCCGGTACAACTGTCAAGATTACGCCTCAGATTAGTCTCAGAAGGTGAGATGACA
GAATCATGGATTGGGCTGCCATTAACCAAAGTCAGAGCGATTCAGCCTGATGGTAGTGTCTTGCTACACACCGAAGATTA
TATTCCTCCGGTGACGGGTTATGCCGCAAGTTCATTGCTGTCTGAATGGTTAACCCATCTTAATGGTTTGGTTAAAATGC
GCGCAGAGATGTTGGCCAATCGCTTGTCAAACAGTGATGGGAAAGCGAGCGCCAGCGCAGAAATTGTCGATTATTTGCTA
CTGCAAATTTTTAATAAATATGAGCCGATTCTCGATCATTTAAGGCACATTCCTGAATTACCACCTATTACGCTTTATCA
GGAATTGGCTAAGTTCTCGGGGGAATTATCTACCTTTATCCGGACCAAAACCCGCCGACCCCGTCCGGCACCTGGCTATG
ATCATGCGAAGCTCTATGCGTCTATTCGTCCGTTGGTTGACGAAGTTCATGAACTACTGAACCAGATCTTGGTGCGTGCT
GGGCAGATGATACCGCTGGAGACGAAAGGCAATGGCGTTTGGTCTGCCTCCGTACTGCCTAATGAATTACGCTCGTTTTC
AAATCTGGTCCTTGCCGTTCATGCGCAATTACCGATGGATGTGCTACAGCATCAATTTTCAGTACAAACAAAAATCAGCG
CACCTCAGCAATTGCATGAACTGGTGCGATCGCATTTGCCAGGGTTGGAACTACAGCGTTTGCCAGTACCGCCCAGACAA
ATTCCGTATAGCGCAGGGTACGTTTATTTTGAATTGATAAAAAATGGCCCCTTCTGGGACAAGGTTTCCAATGCTGGTGC
CATTGCCCTGCACGTGGCGGGTGATTTCCCGGCCTTGAAAATGGAGCTCTGGGGGATTAGAGATTCATGA