Detailed information of component protein


Summary

Component ID T6CP002551
Component protein type TssJ
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (180 a.a.); Nucleotide sequence (540 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07480
Coordinate (Strand) 1640598..1641137 (+)
NCBI ID WP_002211572.1
RefSeq NC_010465
Uniprot ID A0A5P8RT11_YERPE, A0A0U1QVX5_YERP3, A0A3G5L8U4_YERPE, A0A3G5KK48_YERPU
KEGG ID ypc:BZ23_2244, ypw:CH59_3138, ypl:CH46_2169, ypu:BZ21_1960, ypr:BZ20_3546, ypj:CH55_4143, ypv:BZ15_595, ypi:YpsIP31758_1370, ypq:DJ40_3880
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS-SciN PF12790.9 1.3e-29 38..161

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Inside 1-6 MNKSIR
Transmembrane helix 7-26 GVYRATQYLFLVLVTLLTIA
Outside 27-179 CSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
LIPO(Sec/SPII) 0.9977 pos: 26-27. TIA-CS. MNKSIRGVYRATQYLFLVLVTLLTIA



  Protein sequence: 180 a.a.    

>T6CP002551 NC_010465:1640598-1641137 [Yersinia pseudotuberculosis YPIII] [TssJ]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKSTDEFQSSDFFT
ITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQ
DPIMKVRVERLSISIKEMD*

  Nucleotide sequence: 540 bp    

>T6CP002551 NC_010465:1640598-1641137 [Yersinia pseudotuberculosis YPIII] [TssJ]
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGACGATAGCCTG
TAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAACTTACCGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATA
AAGGGGTGGCGAACCCGCTAAGGATTGCGCTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACT
ATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAA
AAAAATAGAGCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGT
GGAAAGCGGTTATTTATCCGTTGCCCAAAAAGCGCGTGGACCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAA
GATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA