Detailed information of component protein


Summary

Component ID T6CP002549
Component protein type TssC
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (501 a.a.); Nucleotide sequence (1503 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07470
Coordinate (Strand) 1638004..1639506 (+)
NCBI ID WP_002211574.1
RefSeq NC_010465
Uniprot ID A0A5P8RRV3_YERPE, A0A0E8XLM4_9GAMM, Q668S2_YERPS, A0A0U1QUJ4_YERP3, A0A0E1NLU4_YERPA, A0A0T9QX22_9GAMM, A0A0H2YHV8_YERPN, A0A0H3B3I3_YERPY, A0A380PGA5_YERPE, A0A3G5LCM6_YERPE, A0A0T9JCU8_YERPU
KEGG ID ypj:CH55_4141, ypn:YPN_1443, ypu:BZ21_1962, yps:YPTB2665, ypa:YPA_2129, ysi:BF17_22810, ypr:BZ20_3544, ypy:YPK_1480, ypl:CH46_2167, ypv:BZ15_593, ypw:CH59_3136, ypi:YpsIP31758_1368, ype:YPO2938, ypo:BZ17_3973, ypc:BZ23_2246, ypq:DJ40_3878
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
VipB PF05943.14 9.5e-136 69..372
VipB_2 PF18945.2 1.8e-44 382..493

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-500 MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAKLPSLKDVA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9788 - -



  Protein sequence: 501 a.a.    

>T6CP002549 NC_010465:1638004-1639506 [Yersinia pseudotuberculosis YPIII] [TssC]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIAEIDRKLSD
QINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPY
GCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHT
FPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSR
FAHYLKCIVRDKIGSFKERDEMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA*

  Nucleotide sequence: 1503 bp    

>T6CP002549 NC_010465:1638004-1639506 [Yersinia pseudotuberculosis YPIII] [TssC]
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATACATTACTGAC
TAAAGAATTTAAAGCGAAGTCTGAGCAGACGATAGCAGCAGTAGAAGGTGCCGTTAAAACGTTGGCTGAGCAAGCGCTGG
CTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGCATTGCTTCCATTATTGCAGAGATTGATCGCAAGCTATCAGAT
CAGATTAATTTAATTTTGCACCACCAAGAATTCCAGTCTCTGGAAAGCGCATGGCGTGGGCTACACTATTTAGTCAATAA
CACCGAGACTGATGAGAAGTTGAGATTACGTTTCCTCGACATCTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATA
AAGGTGTTGCTTGGGATCAAAGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAACTGGGTGGCGAACCATAC
GGTTGCCTGGTAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
GTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTGTCAAACCCAC
GTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTCAGTCTGAAGACTCTCGCTAT
ATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAATACCAACCCGGTAGATGCCTTCCATTTTGA
AGAGACGACGGATGGCGCGGATCACAGCAAATATGTGTGGTCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGAT
CTTTCAAAGAGTATGGCTGGTGTACGCTGATTCGTGGGGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACC
TTCCCGACGGATGACGGCGGTATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGC
CAAGAATGGTTTTATTCCACTGGTTCACAGAAAGAATACTGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGCTTGTTCACGT
TTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTCAAAGAGCGTGATGAGATGCAACGTTGGTTGAA
TGACTGGGTGATGAACTATGTTGATGGTGACCCGGCTAACTCTTCTCTGGAAACTAAAGCGCGCCGTCCTTTAGCCGCTG
CTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTACTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTA
GAAGGTTTGACAGTCTCCCTGCGTATGGTTGCTAAACTGCCTTCGCTGAAAGACGTAGCATAA