Detailed information of component protein


Summary

Component ID T6CP002548
Component protein type TssB
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (175 a.a.); Nucleotide sequence (525 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07465
Coordinate (Strand) 1637456..1637980 (+)
NCBI ID WP_002211575.1
RefSeq NC_010465
Uniprot ID A0A5P8RZ13_YERPE, Q668S1_YERPS, A0A0U1QVR4_YERP3, A0A0E1NM55_YERPA, A0A0H2YG87_YERPN, A0A0H3B2H9_YERPY, A0A380PEA5_YERPE, A0A3G5LE20_YERPE, A0A0T9JDD6_YERPU
KEGG ID yps:YPTB2666, ypo:BZ17_3972, ypi:YpsIP31758_1367, ypj:CH55_4140, ypw:CH59_3135, ypy:YPK_1479, ype:YPO2939, ypn:YPN_1442, ypl:CH46_2166, ypc:BZ23_2247, ypq:DJ40_3877, ypa:YPA_2130, ypr:BZ20_3543, ypu:BZ21_1963, ypv:BZ15_592
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_VipA PF05591.14 1.4e-56 12..162

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-174 MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9956 - -



  Protein sequence: 175 a.a.    

>T6CP002548 NC_010465:1637456-1637980 [Yersinia pseudotuberculosis YPIII] [TssB]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNFDERMKAMKPR
VAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTTLA
SAPKAKQSAVDTPQ*

  Nucleotide sequence: 525 bp    

>T6CP002548 NC_010465:1637456-1637980 [Yersinia pseudotuberculosis YPIII] [TssB]
ATGGTTAGCAAAAGTAATTCTCAAAAGTTTATTGCTCGAAACCGAGCGCCACGCGTGCAGATTGAATACGATGTGGAAAT
ATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGGTATTAGCAGATTTATCCGGTAAACCTCTTGAGCCTT
TACCTTCAGTCGCTGACAGAAAACTGTTAGATATCGATATTGATAATTTCGATGAGCGCATGAAAGCAATGAAACCACGT
GTTGCATTCGCCGTGCTGAATACATTGACTGGGGAAGGCCAGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTT
CTCTCCTGACGCTATCGCGAAAAAAGTTGATTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGA
CTTATATGGATGGTAAGGCGGGTGCTGAGGAATTAGTCATGAAATTGCTGAAAGACAAATCATTACTGACAACGCTTGCA
TCCGCACCGAAAGCAAAACAATCCGCTGTTGATACTCCACAGTAA