Detailed information of component protein


Summary

Component ID T6CP002547
Component protein type TssH
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (886 a.a.); Nucleotide sequence (2658 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07435
Coordinate (Strand) 1629626..1632283 (+)
NCBI ID WP_012104866.1
RefSeq NC_010465
Uniprot ID A0A0H3B2H5_YERPY, A0A0U1QVA9_YERP3, A0A3G5JQM1_YERPU
KEGG ID ypc:BZ23_2252, ypq:DJ40_3872, ypi:YpsIP31758_1362, ypy:YPK_1474, ypr:BZ20_3538
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
AAA_2 PF07724.16 4.7e-38 619..785
AAA_lid_9 PF17871.3 2.3e-29 373..472
ClpB_D2-small PF10431.11 1.3e-15 791..870
AAA PF00004.31 6.9e-10 233..364

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-885 VAITRKHLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLWHQEDNDLKQIIRYFAVDVDAFERELAQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTRIRSGHLLLALLTTMELRRAFFAIAPSMEKIPLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASNAIGAAKSGGTLAQYTTDLTALAREGKIDPVLGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLALAIAAGSMPPALSQVSLLSLDIVALSAGASMKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNAGTGDAANLLKPALARGQLRTIGATTWSEFKRHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKAISLLDTACARIAVAQHSQPIELQHLTFQSETAQTELVSLEKARHFGKAQDARTEQLKTSIAEHGEAADKLDQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQLEAQLSQVRTSLPLVQTEVNAEVIASIVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGENIMTARAGLSDPRKPLGVFMLVGPSGVGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEIEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLLADPDTAPDQDGILTALQPELLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGARLYSQHQLTLKYSDEVVDDVVSRCAVSETGARMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGFVIALQ



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9955 - -



  Protein sequence: 886 a.a.    

>T6CP002547 NC_010465:1629626-1632283 [Yersinia pseudotuberculosis YPIII] [TssH]
VAITRKHLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLWHQEDNDLKQIIRYFAVDVDAFERELAQALAKLPVG
ATSISDFSYHIELATERAWIYASLECLDTRIRSGHLLLALLTTMELRRAFFAIAPSMEKIPLEHLSKDLNFITQASPEAN
EAASDGSPLYDGALPGEASNAIGAAKSGGTLAQYTTDLTALAREGKIDPVLGRNHEINTMVDILLRRRQNNPLLTGDAGV
GKTAIVEGLALAIAAGSMPPALSQVSLLSLDIVALSAGASMKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNA
GTGDAANLLKPALARGQLRTIGATTWSEFKRHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWIMDEAL
QAAVRLSHRYIPARQLPDKAISLLDTACARIAVAQHSQPIELQHLTFQSETAQTELVSLEKARHFGKAQDARTEQLKTSI
AEHGEAADKLDQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQLEAQLSQVRTSLPLVQTEVNAEVIAS
IVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGENIMTARAGLSDPRKPLGVFMLVGPSGVGKTETALAI
AESMYGGEQNMITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEIEKAHSDVHELFFQVFDKGQ
MEDGEGRFIDFKNTILLLTSNVGSELLSNLLADPDTAPDQDGILTALQPELLKVFPAAFLGRVTVIPYLPLQQDALQHIV
RLHLDRIGARLYSQHQLTLKYSDEVVDDVVSRCAVSETGARMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGF
VIALQ*

  Nucleotide sequence: 2658 bp    

>T6CP002547 NC_010465:1629626-1632283 [Yersinia pseudotuberculosis YPIII] [TssH]
GTGGCTATTACAAGGAAACATCTCTTCGGCAAGCTGGACGCCACTCTTTTCAAAGGTATTGAAAGCGCAACAACGATTTG
TAAATTACGCGGCAATCCTTACGTAGAGTTAGTTCACTGGTTGAATCAGCTTTGGCATCAGGAAGATAACGACCTTAAGC
AGATTATTCGGTATTTTGCGGTGGATGTGGATGCCTTTGAGCGTGAGCTGGCTCAGGCACTTGCGAAGTTACCTGTCGGG
GCAACTAGCATTTCAGATTTTTCGTATCATATTGAGTTGGCCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTT
AGATACCCGTATCCGGAGTGGACACCTGCTGCTTGCGCTATTAACAACAATGGAACTGCGGAGAGCTTTCTTTGCGATTG
CGCCAAGCATGGAAAAAATTCCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACCAGAAGCGAAT
GAAGCAGCCAGTGATGGCAGCCCGTTGTACGATGGAGCTTTACCTGGCGAAGCCAGTAATGCCATCGGTGCGGCAAAAAG
TGGTGGCACACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTGAAGGCAAGATAGATCCGGTATTGGGACGTA
ATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCGTCGGCAGAACAACCCATTACTGACCGGTGACGCAGGGGTG
GGTAAAACCGCCATTGTTGAAGGGCTAGCATTGGCCATTGCTGCAGGCTCAATGCCGCCAGCATTAAGCCAGGTAAGCCT
GTTGTCATTAGATATTGTGGCGCTCTCAGCGGGTGCCAGCATGAAAGGTGAATTTGAAGCGCGCCTGAAGAGTGTCTTGG
ATGAAGCAATCGCGGCAGAAAAGCCCGTTATTTTGTTTATCGATGAAGTCCACACACTTATTGGCGCGGGTGGCAATGCC
GGGACCGGCGATGCGGCGAACTTATTGAAACCTGCATTGGCGCGTGGCCAATTACGTACCATTGGTGCGACAACGTGGAG
CGAGTTCAAGCGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCAAGTTGATGAGCCCGATGAGA
ACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCACCATGGCGTGTGGATTATGGACGAAGCCTTA
CAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGCGTCAGTTGCCGGATAAAGCGATAAGTCTGCTTGATACGGC
TTGTGCCCGGATCGCTGTTGCACAGCATTCACAACCAATAGAGTTGCAGCACTTAACCTTCCAGAGTGAGACCGCGCAAA
CTGAGCTGGTTTCCTTAGAGAAAGCGCGGCACTTTGGTAAAGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATT
GCTGAACATGGCGAGGCTGCAGATAAACTTGATCAGCGTTGGCAGGCAGAACGCGAATTGGTATCAGCGATTACGACCAT
AAGAACCGCACTTTATGACTTGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCGCAATTAGTCC
AGTTGGAAGCGCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCAACGCTGAAGTGATCGCCAGT
ATCGTTGCAGATTGGACCGGCATCCCGGTTGGGCAAATGCTCAAAGACGATATTCGGGCGGTAATGGAGTTGCCACAGCG
CCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATGCAACTGGGTGAGAATATTATGACCGCACGCGCCGGTCTGT
CAGACCCAAGGAAACCATTGGGGGTCTTTATGTTAGTGGGGCCTTCAGGTGTGGGTAAAACAGAGACGGCCTTAGCGATT
GCCGAGAGCATGTATGGTGGTGAACAGAATATGATCACTATCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTC
TTTAAAAGGTTCTCCACCGGGATATGTTGGATACGGTGAAGGCGGTGTATTAACGGAAGCCGTGCGCCGTAAGCCATATA
GTGTTGTGTTATTAGATGAAATCGAAAAAGCGCACTCTGATGTACATGAATTATTCTTCCAAGTGTTTGATAAAGGCCAA
ATGGAAGATGGTGAAGGGCGCTTTATCGATTTCAAAAACACTATTTTGCTGTTAACCAGTAATGTGGGCAGCGAGTTACT
GAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATATTAACTGCGTTACAACCTGAATTGCTGAAAG
TTTTCCCAGCAGCATTTTTAGGGCGAGTCACGGTTATTCCTTATCTTCCGTTACAGCAAGATGCATTGCAGCACATTGTA
CGGTTACATCTTGACCGGATTGGCGCTCGTTTATACTCGCAGCATCAATTGACACTGAAATACAGTGATGAAGTGGTTGA
CGATGTTGTTAGCCGCTGTGCGGTTTCAGAAACCGGTGCACGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAA
AAATAGGTAAATATATTTTAGGTGATAGTGATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTC
GTGATCGCTTTACAATGA