Detailed information of component protein


Summary

Component ID T6CP002546
Component protein type TssF
T6SS ID (Type) T6SS00258 experimental (Type i3)
Strain Yersinia pseudotuberculosis YPIII
Replicon chromosome
Sequence Protein sequence (627 a.a.); Nucleotide sequence (1881 bp)
Reference
experimental Experimental investigation has been performed on this T6SS

External database links

Locus tag (Gene) YPK_RS07430
Coordinate (Strand) 1626962..1628842 (-)
NCBI ID WP_002211582.1
RefSeq NC_010465
Uniprot ID A0A0H2Y9L2_YERPA, A0A0H2YHV0_YERPN, A0A0H3B1K7_YERPY, A0A0U1QVU9_YERP3, A0A3G5IXH3_YERPU, A0A5P8YHX9_YERPE, A0A656FG34_YERPE, A0A6B3T676_YERPE, Q668R5_YERPS
KEGG ID ypi:YpsIP31758_1361, ypa:YPA_2138, yps:YPTB2672, ypn:YPN_1433, ypy:YPK_1473, ype:YPO2947, ypk:y1537, ypm:YP_2574
PDB ID -

Pfam domain hit(s)

Domain Pfam ID E-value Aligned region
T6SS_TssF PF05947.14 1.8e-215 2..623

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-626 VDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9964 - -



  Protein sequence: 627 a.a.    

>T6CP002546 NC_010465:c1628842-1626962 [Yersinia pseudotuberculosis YPIII] [TssF]
VDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVY
PNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDMPNLEK
HRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHGETAKDTVISDQPLSF
EGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACT
PVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKAR
TGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPS
APRAPFAMDESAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL*

  Nucleotide sequence: 1881 bp    

>T6CP002546 NC_010465:c1628842-1626962 [Yersinia pseudotuberculosis YPIII] [TssF]
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAAATGGCGCAAGAGTTTGCTGAAAAACA
TCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGATCCTTACGTTGAGCGGCTGATAGAGTCCTTCT
GTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAATTTACTCAGCGTCTTTTGGACATTGTCTAT
CCCAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCCAACTTAAGCCAAATCTGAAGGAAGGGGATTTGACTCAAGG
GTATTGTGTTCCTAGGGGCAGCTCGTTCTTCACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGTAGTGGTC
AGGATGTGGAGTTGTGGCCACTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAG
CACCGCATTGCCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGAATCGTTTCACATATCTTCGAGCTACTCCACGCCA
GCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAGACAGCAAAAGACACCGTGATCAGTGATCAGCCACTGTCCTTT
GAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTTTCACGGACATAATCTGGTGCAGGAGTATTT
TACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAGCTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGG
AAATCATCATCCTACTGGACAGATTACCGCAGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCTGCACG
CCAGTGATTAATCTCTTTCCTAAACGCATGGATAAGATCGAAATTAACCGTGCATTGAACGATTTTCACGTAGTACCAGA
CCGCAGCCGCCCACTGGATTATGAAGTTTTCGCCATTAATAAAGTATTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCGCAAGGCCAGA
ACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTCTTTGTCTCGTTGGTCGATCA
ACAAGAGGCGCCTTATGGCGATAGCTTGCGCTACCTCTCTATTGAAGCTCAGGTGACTAATCGGGATCTTCCGCGCCTGA
TTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTCAGCGCCCGTTCACGGTGCCCGGTTTGTGTTCCAACCCAGC
GCCCCACGCGCCCCCTTTGCCATGGATGAATCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTC
AGATATGTCCCACTCGAATGGGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGA
ATACACAAATTGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACCTTGACTGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTGGCATGATCAT
GGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTCCATGCAAAGAGGACGTGTCG
GTCACTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA